← Back to history

Pipeline run

2243157d-c955-4348-be07-5c5aefb33766

Pipeline LLM cost (USD)
API 1: $0.0100 API 2: $0.0001 API 3: $0.0000 Total: $0.0102

Client output enrichment

v2 Skill cluster · Nature of work · AI index · Tech stack maturity · Evidence · KRA description
SPARSE JD OVERLAP · web-developer role baseline loaded sources · ai_index: role_baseline · nature_of_work: jd · tech_stack_maturity: jd
Nature of work · API and service implementation
Works in an Agile team to turn client requirements into detailed designs, write and test Python/FastAPI code, and provide technical support across development and CI/CD workflows. Also includes front-end web markup and scripting work.
""developing detailed design plans, writing quality code, and providing technical support.""
Tech stack maturity
Mainstream Modern
The skill set centers on contemporary web and backend development with FastAPI, Django, CI/CD, DevOps, pytest, and modern frontend tooling, which is characteristic of cloud-native modern engineering.
AI index (0 = no AI use, 5 = totally AI-dependent · v2.1)
2.20 / 5
· Title match
· Has AI skill
· AI skill (primary)
· AI skill (secondary)
· On AI team
· Builds AI products
vocab breakdown (legacy)
Assistants (×1):
Frameworks (×2):
Models / concepts (×3):
Evidence — skills matched in JD (16)
Python FastAPI React Agile Git Perforce CI/CD TypeScript pytest Django JavaScript HTML CSS SVN DevOps API
Skill cluster (7 dimension groups, role-scoped)
Programming Languages
Python TypeScript JavaScript
Web Application Frameworks
FastAPI Django
CI/CD Pipeline Platforms
DevOps
React Component Architecture
React
Styling and Responsive Layout
CSS
Testing and Quality Assurance
pytest
Cross-cutting / unaligned
Agile Git Perforce CI/CD HTML SVN API
Show KRA description ↓
collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support. fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api

Signals

Skill full-stack-engineer
0.50
Alias backend-engineer
1.00
KRA flutter-developer
0.51

Post-classification

Centroidupdated · n=779
Alias collision log
New-role queue
New skills captured2
New KRA capturedyes

Captured for admin review

Perforce primary Backend Developer pending
SVN primary Backend Developer pending
R&R fragment (sim 0.00) Backend Developer pending

collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support. fastapi,react,agile,git,design,perforce,ci/…

Status: completed Created: 2026-05-27T15:03:01.260539Z Updated: 2026-06-12T16:56:12.216057Z API 3 duration: 85015 ms
Flow Current 3-step pipeline

1 POST /skills/extract-from-jd

2 POST /skills/extract-details

3 POST /skills/final-role-output

Role Chosen role & resolution

Backend Developer

Python Backend Developer

sub-role · 0.99 domain · Software Engineering CASE DOMAIN

slug: backend-engineer · id: 1 · source: db · sub-role slug: python-backend-developer

Domain=Software Engineering → sub-role python-backend-developer; The JD centers on Python-based application development with FastAPI/Django, APIs, CI/CD, and technical support, which best matches a backend developer role.

Matched skills

Pythonfastapidjangoapipytestgitci/cddevopsagilejavascripttypescriptreacthtmlcsssvnperforce

Matched dimensions

Backend Application DevelopmentAPI DevelopmentAgile CollaborationTechnical Design and SupportQuality Code DeliveryDevOps and CI/CD Practices

Matched KRAs

collaborating in an Agile teamunderstanding client requirementsdeveloping detailed design planswriting quality codeproviding technical support

Resolution: in_db — role exists in library; skill↔dim and role↔dim links saved when applicable.

0
New skills
0
Skill↔dim saved
0
Role↔dim saved
0
Skipped

Job description

We are looking for an experienced Python Developer with 4-6 years of proven expertise and an Engineering background. The ideal candidate must be proficient in FastAPI and Django for API-driven applications, and possess a strong understanding of Python design patterns. Experience with CI/CD pipelines and pytest for testing is essential.

A basic knowledge of HTML, CSS, TypeScript, and JavaScript (React framework) is required for web projects. Familiarity with version control systems like Git, SVN, or Perforce, and exposure to DevOps practices is also necessary.

Key responsibilities include collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support. Strong problem-solving skills and eagerness to stay updated on the latest Python trends through active learning are essential.

Skills: fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api

Skills from this JD

Each row merges API 1 extraction, API 2 library match / v3 orchestration (dimensions + locked dims), and API 3 persistence tags.

Python Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: Python id=5 · python

Aliases — catalog

  • Python (CANONICAL) primary
  • Python 2 (VERSION)
  • Python 2.x (VERSION)
  • Python 3 (VERSION)
  • Python 3.10 (VERSION)
  • Python 3.11 (VERSION)
  • Python 3.12 (VERSION)
  • Python 3.x (VERSION)
  • py (VERSION)
  • py2 (VERSION)
  • py3 (VERSION)
  • python 3 (VERSION)
  • python 3.x (VERSION)
  • python2 (VERSION)
  • python3 (VERSION)
  • python3.x (VERSION)

Context tags (catalog)

API Django FastAPI Flask Jupyter NumPy PEP 8 Pandas REST SQLAlchemy asyncio pandas pip pytest type hints venv virtualenv

Stored enrichment (catalog DB)

Category
Language
Sub-category
Programming Language
Vendor
PSF
License
mit
Year introduced
1991
Confidence
0.99
Version strategy
SEPARATE_ENTITY
Version tag
3

Maturity reasoning: Python appears in a very high volume of job descriptions across data, backend, automation, and ML roles, and remains a default hiring-pipeline language on major job boards and tech stacks.

Skill profile (library / DB)

Skill nature
LANGUAGE
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
6
Sub-category id
96
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Cloud Security Scripting & DSL Languages Catalog dimension db id 248

    Library dimension (catalog)

    Roles linked in library: Cloud Security Engineer

  • Programming Languages Catalog dimension db id 1

    Library dimension (catalog)

    Roles linked in library: Backend Developer, Fullstack Developer, Fullstack Developer

  • Programming Languages & DSLs Catalog dimension db id 475

    Library dimension (catalog)

    Roles linked in library: Engineering Manager

  • Programming Languages and Scripting Catalog dimension db id 59

    Library dimension (catalog)

    Roles linked in library: Cyber Security Engineer

  • Programming Languages for Data Work Catalog dimension db id 21

    Library dimension (catalog)

    Roles linked in library: Data Engineer

  • Programming Languages for ML Systems Catalog dimension db id 39

    Library dimension (catalog)

    Roles linked in library: ML Engineer, MLOps Engineer

  • Programming Languages for XR Catalog dimension db id 97

    Library dimension (catalog)

    Roles linked in library: AR/VR Engineer

  • Python Programming Catalog dimension db id 290

    Library dimension (catalog)

    Roles linked in library: Python Backend Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Cloud Security Scripting & DSL Languages
cloud-security-scripting-dsl-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages
programming-languages
Existing dimension (library) · Role↔dimension saved
Programming Languages & DSLs
programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages and Scripting
programming-languages-and-scripting
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages for Data Work
programming-languages-for-data-work
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages for ML Systems
programming-languages-for-ml-systems
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages for XR
programming-languages-for-xr
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python Programming
python-programming
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
FastAPI Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: FastAPI id=1201 · fastapi

Aliases — catalog

  • FastAPI (CANONICAL) primary

Context tags (catalog)

API documentation ASGI CORS JSON JSON Schema OAuth2 OpenAPI Pydantic RESTful Starlette UVicorn WebSocket async async programming data validation dependency injection middleware path parameters query parameters type hints uvicorn

Stored enrichment (catalog DB)

Category
Framework
Sub-category
Web Framework
Vendor
Sebastián Ramírez
License
mit
Year introduced
2018
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: FastAPI appears in many Python backend job postings and has strong GitHub adoption; it’s now a common choice for API development alongside Flask/Django rather than a niche tool.

Skill profile (library / DB)

Skill nature
FRAMEWORK
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
5
Sub-category id
35
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • React Frontend Development Catalog dimension db id 96

    Library dimension (catalog)

  • Web Application Frameworks Catalog dimension db id 2

    Library dimension (catalog)

    Roles linked in library: Backend Developer, Fullstack Developer, Fullstack Developer, Java Backend Developer, Node.js Backend Developer, PHP Backend Developer, Python Backend Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Web Application Frameworks
web-application-frameworks
Existing dimension (library) · Role↔dimension saved
React Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: React id=610 · react

Aliases — catalog

  • React (CANONICAL) primary
  • React 0.13 (VERSION)
  • React 0.14 (VERSION)
  • React 15 (VERSION)
  • React 15.x (VERSION)
  • React 16 (VERSION)
  • React 16.x (VERSION)
  • React 17 (VERSION)
  • React 17.x (VERSION)
  • React 18 (VERSION)
  • React 18.x (VERSION)
  • React 19 (VERSION)
  • React v15 (VERSION)
  • React v16 (VERSION)
  • React v17 (VERSION)
  • React v18 (VERSION)
  • React v19 (VERSION)
  • ReactJS 18 (VERSION)
  • react 15 (VERSION)
  • react 16 (VERSION)
  • react 17 (VERSION)
  • react 18 (VERSION)
  • react 19 (VERSION)
  • react15 (VERSION)
  • react16 (VERSION)
  • react17 (VERSION)
  • react18 (VERSION)
  • react19 (VERSION)
  • reactjs 18 (VERSION)

Context tags (catalog)

Babel Class Components Component Lifecycle Context API Functional Components Higher-Order Components Hooks JSX Next.js PropTypes Props React Native React Router Redux SSR State Management Styled Components Testing Library TypeScript Virtual DOM Webpack component lifecycle context API frontend hooks props state management useEffect useState virtual DOM

Stored enrichment (catalog DB)

Category
Framework
Sub-category
Frontend Framework
Vendor
Meta
License
mit
Year introduced
2013
Confidence
0.98
Version strategy
SEPARATE_ENTITY
Version tag
18

Maturity reasoning: React appears in high-volume frontend job postings across startups and enterprises and remains a default hiring-pipeline skill, with strong GitHub/npm usage and ecosystem activity.

Skill profile (library / DB)

Skill nature
FRAMEWORK
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
5
Sub-category id
1072
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Application Frameworks & Libraries Catalog dimension db id 451

    Library dimension (catalog)

    Roles linked in library: Sitecore Dev

  • Frameworks & Libraries Catalog dimension db id 360

    Library dimension (catalog)

    Roles linked in library: Drupal Dev, Engineering Manager

  • Frontend Frameworks and Libraries Catalog dimension db id 434

    Library dimension (catalog)

    Roles linked in library: Shopify Dev

  • JavaScript for WordPress Catalog dimension db id 329

    Library dimension (catalog)

    Roles linked in library: WordPress Dev

  • React Component Architecture Catalog dimension db id 302

    Library dimension (catalog)

    Roles linked in library: React Frontend Developer

  • UI Frameworks and Rendering Catalog dimension db id 115

    Library dimension (catalog)

    Roles linked in library: Frontend Developer, Fullstack Developer, Fullstack Developer, Hybrid Mobile Developer, Ionic Developer, Web Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Application Frameworks & Libraries
application-frameworks-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Frameworks & Libraries
frameworks-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Frontend Frameworks and Libraries
frontend-frameworks-and-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript for WordPress
javascript-for-wordpress
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React Component Architecture
react-component-architecture
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
UI Frameworks and Rendering
ui-frameworks-and-rendering
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Agile Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: Agile id=520 · agile

Aliases — catalog

  • Agile (CANONICAL) primary

Context tags (catalog)

Kanban SAFe Scrum backlog backlog grooming burndown burndown chart continuous delivery continuous improvement cross-functional daily standup epics incremental development iteration iteration planning lean product backlog product owner retrospective sprint sprint planning stand-up story points user stories velocity

Stored enrichment (catalog DB)

Category
Methodology
Sub-category
Agile
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: Agile appears in a large share of software job descriptions and is a standard hiring-pipeline requirement; Scrum/Kanban are commonly listed alongside it, showing broad market adoption.

Skill profile (library / DB)

Skill nature
METHODOLOGY
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
8
Sub-category id
3594
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • React Frontend Development Catalog dimension db id 96

    Library dimension (catalog)

  • Software Concepts, Patterns & Practices Catalog dimension db id 478

    Library dimension (catalog)

    Roles linked in library: Engineering Manager

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Software Concepts, Patterns & Practices
software-concepts-patterns-practices
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Git Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: Git id=1002 · git

Aliases — catalog

  • Git (CANONICAL)

Context tags (catalog)

CI/CD GitHub GitLab branching checkout clone commit fork merging pull request rebase remote repository stash versioning

Stored enrichment (catalog DB)

Category
Tool
Sub-category
Version Control Tool
Vendor
Linus Torvalds
License
gpl_v2
Year introduced
2005
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: Git is a hiring-pipeline staple: it appears in the vast majority of software engineering job descriptions and is the default VCS on GitHub/GitLab/Bitbucket.

Skill profile (library / DB)

Skill nature
TOOL
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
13
Sub-category id
730
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • React Frontend Development Catalog dimension db id 96

    Library dimension (catalog)

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Perforce Primary New / orchestrated API 3: new canonical path (new) New / unmatched skill (orchestrated in API 2)

Skill enrichment (orchestrator / LLM)

No Stage 7 enrichment blob on this skill (orchestrator skipped enrichment).

Derived legacy fields
Category
Version Control Systems
Sub-category
general
Skill nature
TOOL
Volatility
MEDIUM
Typical lifespan
MULTI_YEAR
Version strategy
UNVERSIONED
CI/CD Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: CI/CD id=1190 · ci-cd

Aliases — catalog

  • CI/CD (CANONICAL)

Context tags (catalog)

Ansible CircleCI Docker GitLab CI Jenkins Kubernetes Terraform Travis CI automated testing build automation continuous deployment continuous integration deployment pipelines monitoring version control

Stored enrichment (catalog DB)

Category
Methodology
Sub-category
Ci Cd Process
Confidence
0.93
Version strategy
NOT_APPLICABLE

Maturity reasoning: CI/CD appears in a large share of software engineering JDs and is a standard requirement across DevOps, platform, and backend roles; major vendors like GitHub, GitLab, and AWS all center product roadmaps on CI/CD pipelines.

Skill profile (library / DB)

Skill nature
METHODOLOGY
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
8
Sub-category id
900
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • CI/CD Pipeline Platforms Catalog dimension db id 150

    Library dimension (catalog)

    Roles linked in library: DevOps Engineer

  • CI/CD for Machine Learning Catalog dimension db id 56

    Library dimension (catalog)

    Roles linked in library: ML Engineer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
CI/CD Pipeline Platforms
ci-cd-pipeline-platforms
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CI/CD for Machine Learning
ci-cd-for-machine-learning
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
TypeScript Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: TypeScript id=524 · typescript

Aliases — catalog

  • TypeScript (CANONICAL) primary
  • TypeScript 5 (VERSION)
  • TypeScript 5.x (VERSION)
  • ts (VERSION)
  • ts5 (VERSION)
  • typescript 5 (VERSION)
  • typescript 5.x (VERSION)
  • typescript5 (VERSION)

Context tags (catalog)

Angular Async/Await Decorator Deno ESLint Generics GraphQL Interfaces JavaScript Jest NestJS Next.js Node.js Promise React Redux RxJS TypeORM Vite Vue Vue.js Webpack async/await decorators generics interfaces module resolution npm strict mode tsconfig type annotations type guards type inference type safety yarn

Stored enrichment (catalog DB)

Category
Language
Sub-category
Programming Language
Vendor
Microsoft
License
apache_2
Year introduced
2012
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: TypeScript is a hiring-pipeline staple: it appears in a large share of modern web/frontend and Node.js job descriptions, and major frameworks like Angular and Next.js recommend it by default.

Skill profile (library / DB)

Skill nature
LANGUAGE
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
6
Sub-category id
96
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Cross-Platform App Languages Catalog dimension db id 167

    Library dimension (catalog)

    Roles linked in library: Hybrid Mobile Developer

  • JavaScript and TypeScript Catalog dimension db id 114

    Library dimension (catalog)

    Roles linked in library: Angular Frontend Developer, Frontend Developer, Ionic Developer, Node.js Backend Developer, React Frontend Developer, React Native Developer, Svelte Frontend Developer, Vue Frontend Developer, Web Developer

  • Programming Languages Catalog dimension db id 1

    Library dimension (catalog)

    Roles linked in library: Backend Developer, Fullstack Developer, Fullstack Developer

  • Programming Languages for XR Catalog dimension db id 97

    Library dimension (catalog)

    Roles linked in library: AR/VR Engineer

  • Sitecore Development Languages Catalog dimension db id 438

    Library dimension (catalog)

    Roles linked in library: Sitecore Dev

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Cross-Platform App Languages
cross-platform-app-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript and TypeScript
javascript-and-typescript
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages
programming-languages
Existing dimension (library) · Role↔dimension saved
Programming Languages for XR
programming-languages-for-xr
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
pytest Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: pytest id=2370 · pytest

Aliases — catalog

  • pytest (CANONICAL) primary

Context tags (catalog)

assert command line options coverage report fixture mock parameterized tests plugins pytest-bdd pytest-cov pytest-xdist test discovery test runner test suite tox unittest

Stored enrichment (catalog DB)

Category
Tool
Sub-category
Testing Tool
Vendor
pytest-dev
License
mit
Year introduced
2014
Confidence
0.97
Version strategy
NOT_APPLICABLE

Maturity reasoning: Pytest appears in many Python job descriptions and is a standard testing tool in the Python ecosystem, with broad GitHub usage and active maintenance.

Skill profile (library / DB)

Skill nature
TOOL
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
13
Sub-category id
513
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Testing and Quality Assurance Catalog dimension db id 12

    Library dimension (catalog)

    Roles linked in library: .NET Backend Developer, Backend Developer, Node.js Backend Developer, PHP Backend Developer, Python Backend Developer, Scala Backend Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Testing and Quality Assurance
testing-and-quality-assurance
Existing dimension (library) · Role↔dimension saved
Django Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: Django id=9 · django

Aliases — catalog

  • Django (CANONICAL) primary
  • Django 1 (VERSION)
  • Django 1.x (VERSION)
  • Django 2 (VERSION)
  • Django 2.x (VERSION)
  • Django 3 (VERSION)
  • Django 3.x (VERSION)
  • Django 4 (VERSION)
  • Django 4.x (VERSION)
  • Django 5 (VERSION)
  • Django 5.x (VERSION)
  • Django1 (VERSION)
  • Django2 (VERSION)
  • Django3 (VERSION)
  • Django4 (VERSION)
  • Django5 (VERSION)
  • django 2 (VERSION)
  • django 2.x (VERSION)
  • django 3 (VERSION)
  • django 3.x (VERSION)
  • django 4 (VERSION)
  • django 4.x (VERSION)
  • django 5 (VERSION)
  • django 5.0 (VERSION)
  • django 5.x (VERSION)
  • django2 (VERSION)
  • django2.x (VERSION)
  • django3 (VERSION)
  • django3.x (VERSION)
  • django4 (VERSION)
  • django4.x (VERSION)
  • django5 (VERSION)
  • django5.0 (VERSION)
  • django5.x (VERSION)

Context tags (catalog)

Celery Django REST Framework Django Signals Jinja2 MVT ORM PostgreSQL QuerySet REST URL routing admin interface admin site authentication celery csrf deployment forms gunicorn middleware migrations models pytest querysets settings signals static files templates views

Stored enrichment (catalog DB)

Category
Framework
Sub-category
Web Framework
Vendor
Django Software Foundation
License
bsd
Year introduced
2005
Confidence
0.99
Version strategy
SEPARATE_ENTITY
Version tag
5

Maturity reasoning: Django appears in many backend web job descriptions and remains a standard Python web framework; its GitHub ecosystem and long-term LTS releases show sustained market demand.

Skill profile (library / DB)

Skill nature
FRAMEWORK
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
5
Sub-category id
35
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Frameworks & Libraries Catalog dimension db id 360

    Library dimension (catalog)

    Roles linked in library: Drupal Dev, Engineering Manager

  • Web Application Frameworks Catalog dimension db id 2

    Library dimension (catalog)

    Roles linked in library: Backend Developer, Fullstack Developer, Fullstack Developer, Java Backend Developer, Node.js Backend Developer, PHP Backend Developer, Python Backend Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Frameworks & Libraries
frameworks-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Web Application Frameworks
web-application-frameworks
Existing dimension (library) · Role↔dimension saved
JavaScript Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: JavaScript id=607 · javascript

Aliases — catalog

  • JavaScript (CANONICAL) primary
  • ES2015 (VERSION)
  • ES2016 (VERSION)
  • ES2017 (VERSION)
  • ES2018 (VERSION)
  • ES2019 (VERSION)
  • ES2020 (VERSION)
  • ES2021 (VERSION)
  • ES2022 (VERSION)
  • ES2023 (VERSION)
  • ES2024 (VERSION)
  • ES5 (VERSION)
  • ES6 (VERSION)
  • JavaScript ES2015 (VERSION)
  • JavaScript ES2020 (VERSION)
  • JavaScript ES6 (VERSION)
  • modern JavaScript (VERSION)

Context tags (catalog)

AJAX Angular Babel DOM DOM manipulation ES6 Express JSON Node.js REST RESTful React TypeScript Vue Vue.js Webpack async/await asynchronous callback callback functions closure event-driven jQuery npm promises

Stored enrichment (catalog DB)

Category
Language
Sub-category
Programming Language
Vendor
Mozilla
License
mpl
Year introduced
1995
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: JavaScript appears in a very high volume of job postings across frontend, backend, and full-stack roles, and remains a core language in major ecosystems like Node.js and React.

Skill profile (library / DB)

Skill nature
LANGUAGE
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
6
Sub-category id
96
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Cross-Platform App Languages Catalog dimension db id 167

    Library dimension (catalog)

    Roles linked in library: Hybrid Mobile Developer

  • JavaScript and TypeScript Catalog dimension db id 114

    Library dimension (catalog)

    Roles linked in library: Angular Frontend Developer, Frontend Developer, Ionic Developer, Node.js Backend Developer, React Frontend Developer, React Native Developer, Svelte Frontend Developer, Vue Frontend Developer, Web Developer

  • JavaScript for WordPress Catalog dimension db id 329

    Library dimension (catalog)

    Roles linked in library: WordPress Dev

  • Pega Programming Languages & DSLs Catalog dimension db id 267

    Library dimension (catalog)

    Roles linked in library: Pega Developer

  • Programming Languages Catalog dimension db id 1

    Library dimension (catalog)

    Roles linked in library: Backend Developer, Fullstack Developer, Fullstack Developer

  • Programming Languages & DSLs Catalog dimension db id 475

    Library dimension (catalog)

    Roles linked in library: Engineering Manager

  • Programming Languages & Template Languages Catalog dimension db id 359

    Library dimension (catalog)

    Roles linked in library: Drupal Dev

  • Sitecore Development Languages Catalog dimension db id 438

    Library dimension (catalog)

    Roles linked in library: Sitecore Dev

  • Storefront JavaScript and DOM Behavior Catalog dimension db id 422

    Library dimension (catalog)

    Roles linked in library: Shopify Dev

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Cross-Platform App Languages
cross-platform-app-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript and TypeScript
javascript-and-typescript
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript for WordPress
javascript-for-wordpress
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Pega Programming Languages & DSLs
pega-programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages
programming-languages
Existing dimension (library) · Role↔dimension saved
Programming Languages & DSLs
programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages & Template Languages
programming-languages-template-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Storefront JavaScript and DOM Behavior
storefront-javascript-and-dom-behavior
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
HTML Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: HTML id=1657 · html

Aliases — catalog

  • HTML (CANONICAL) primary

Context tags (catalog)

ARIA CSS DOM HTML5 JavaScript SEO SVG W3C W3C standards canvas forms front-end development markup validation meta tags microdata responsive design semantic markup web accessibility web components

Stored enrichment (catalog DB)

Category
Language
Sub-category
Markup Language
Vendor
W3C
License
unknown
Year introduced
1993
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: HTML appears in the vast majority of web/front-end job descriptions and remains a core browser standard; it is not sunset or replaced by a newer markup language.

Skill profile (library / DB)

Skill nature
LANGUAGE
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
6
Sub-category id
1467
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • Pega Programming Languages & DSLs Catalog dimension db id 267

    Library dimension (catalog)

    Roles linked in library: Pega Developer

  • Programming Languages & Template Languages Catalog dimension db id 359

    Library dimension (catalog)

    Roles linked in library: Drupal Dev

  • React Frontend Development Catalog dimension db id 96

    Library dimension (catalog)

  • Sitecore Development Languages Catalog dimension db id 438

    Library dimension (catalog)

    Roles linked in library: Sitecore Dev

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
Pega Programming Languages & DSLs
pega-programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages & Template Languages
programming-languages-template-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CSS Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: CSS id=623 · css

Aliases — catalog

  • CSS (CANONICAL) primary

Context tags (catalog)

Animations BEM Bootstrap Box Model CSS Modules CSS Variables Flexbox Frameworks Grid LESS Less Media Queries Positioning PostCSS Preprocessors Pseudo-classes Responsive Design SCSS SMACSS Sass Selectors Styling Tailwind CSS Transitions Z-index animation media queries pseudo-elements responsive design styled-components

Stored enrichment (catalog DB)

Category
Language
Sub-category
Stylesheet Language
Vendor
W3C
License
unknown
Year introduced
1996
Confidence
0.99
Version strategy
NOT_APPLICABLE

Maturity reasoning: CSS is a core front-end skill in most web JDs and remains standard in MDN/browser docs; it’s broadly used alongside HTML/JS rather than being replaced by a successor.

Skill profile (library / DB)

Skill nature
LANGUAGE
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
6
Sub-category id
486
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • CSS Architecture and Styling Catalog dimension db id 117

    Library dimension (catalog)

    Roles linked in library: Frontend Developer, Fullstack Developer, Fullstack Developer, React Frontend Developer, Svelte Frontend Developer, Vue Frontend Developer, Web Developer

  • Programming Languages & Template Languages Catalog dimension db id 359

    Library dimension (catalog)

    Roles linked in library: Drupal Dev

  • Sitecore Development Languages Catalog dimension db id 438

    Library dimension (catalog)

    Roles linked in library: Sitecore Dev

  • Storefront Styling and Responsive Layout Catalog dimension db id 423

    Library dimension (catalog)

    Roles linked in library: Shopify Dev

  • Styling and Responsive Layout Catalog dimension db id 307

    Library dimension (catalog)

    Roles linked in library: Angular Frontend Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
CSS Architecture and Styling
css-architecture-and-styling
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Programming Languages & Template Languages
programming-languages-template-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Storefront Styling and Responsive Layout
storefront-styling-and-responsive-layout
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Styling and Responsive Layout
styling-and-responsive-layout
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
SVN Primary New / orchestrated API 3: new canonical path (new) New / unmatched skill (orchestrated in API 2)

Skill enrichment (orchestrator / LLM)

No Stage 7 enrichment blob on this skill (orchestrator skipped enrichment).

Derived legacy fields
Category
Version Control Systems
Sub-category
general
Skill nature
TOOL
Volatility
MEDIUM
Typical lifespan
MULTI_YEAR
Version strategy
UNVERSIONED
DevOps Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: DevOps id=1216 · devops

Aliases — catalog

  • DevOps (CANONICAL)

Context tags (catalog)

Agile Ansible Automation CI/CD Cloud-native Continuous Deployment Continuous Integration Docker GitOps Infrastructure as Code Jenkins Kubernetes Microservices Monitoring SRE Terraform

Stored enrichment (catalog DB)

Category
Methodology
Sub-category
Devops Methodology
Confidence
0.97
Version strategy
NOT_APPLICABLE

Maturity reasoning: DevOps appears in a large share of software and platform engineering job descriptions, often alongside CI/CD, Kubernetes, and cloud tooling; it is a standard hiring-pipeline keyword rather than a niche specialty.

Skill profile (library / DB)

Skill nature
METHODOLOGY
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
8
Sub-category id
922
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • CI/CD Pipeline Platforms Catalog dimension db id 150

    Library dimension (catalog)

    Roles linked in library: DevOps Engineer

  • Deployment and Release Patterns Catalog dimension db id 140

    Library dimension (catalog)

    Roles linked in library: Cloud Architect

  • Infrastructure as Code Catalog dimension db id 132

    Library dimension (catalog)

    Roles linked in library: Cloud Architect, DevOps Engineer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
CI/CD Pipeline Platforms
ci-cd-pipeline-platforms
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Deployment and Release Patterns
deployment-and-release-patterns
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Infrastructure as Code
infrastructure-as-code
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
API Primary Library skill API 3: existing canonical (in_db) Existing skill (matched library)
Canonical: API id=1568 · api

Aliases — catalog

  • API (CANONICAL)

Context tags (catalog)

API gateway GraphQL JSON OAuth REST SDK SOAP XML authentication endpoint microservices rate limiting throttling versioning webhooks

Stored enrichment (catalog DB)

Category
Concept
Sub-category
Application Programming Interface
Confidence
0.93
Version strategy
NOT_APPLICABLE

Maturity reasoning: APIs are a core requirement in most software engineering JDs and underpin common integrations across cloud, mobile, and web stacks; major vendors like AWS, Stripe, and Google Cloud center products on API-first usage.

Skill profile (library / DB)

Skill nature
CONCEPT
Volatility
STABLE
Typical lifespan
EVERGREEN
Category id
2
Sub-category id
1174
Extractable
True
Also category
False

Dimensions (API 2 worklist)

  • API Integration and Data Fetching Catalog dimension db id 127

    Library dimension (catalog)

    Roles linked in library: Angular Frontend Developer, Frontend Developer, Fullstack Developer, React Frontend Developer, Svelte Frontend Developer, Vue Frontend Developer, Web Developer

API 3 link attempts (this skill)

Dimension Skill↔dim Role↔dim Outcome
API Integration and Data Fetching
api-integration-and-data-fetching
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)

All API 3 persistence rows

Same grid as the skill-extractor “Persistence items” table: one row per (skill × dimension) work item.

Skill Tag Dimension Skill↔dim Role↔dim Outcome Notes
Python in_db
Cloud Security Scripting & DSL Languages
cloud-security-scripting-dsl-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python in_db
Programming Languages
programming-languages
Existing dimension (library) · Role↔dimension saved
Python in_db
Programming Languages & DSLs
programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python in_db
Programming Languages and Scripting
programming-languages-and-scripting
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python in_db
Programming Languages for Data Work
programming-languages-for-data-work
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python in_db
Programming Languages for ML Systems
programming-languages-for-ml-systems
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python in_db
Programming Languages for XR
programming-languages-for-xr
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Python in_db
Python Programming
python-programming
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
FastAPI in_db
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
FastAPI in_db
Web Application Frameworks
web-application-frameworks
Existing dimension (library) · Role↔dimension saved
React in_db
Application Frameworks & Libraries
application-frameworks-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React in_db
Frameworks & Libraries
frameworks-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React in_db
Frontend Frameworks and Libraries
frontend-frameworks-and-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React in_db
JavaScript for WordPress
javascript-for-wordpress
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React in_db
React Component Architecture
react-component-architecture
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
React in_db
UI Frameworks and Rendering
ui-frameworks-and-rendering
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Agile in_db
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Agile in_db
Software Concepts, Patterns & Practices
software-concepts-patterns-practices
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Git in_db
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CI/CD in_db
CI/CD Pipeline Platforms
ci-cd-pipeline-platforms
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CI/CD in_db
CI/CD for Machine Learning
ci-cd-for-machine-learning
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
TypeScript in_db
Cross-Platform App Languages
cross-platform-app-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
TypeScript in_db
JavaScript and TypeScript
javascript-and-typescript
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
TypeScript in_db
Programming Languages
programming-languages
Existing dimension (library) · Role↔dimension saved
TypeScript in_db
Programming Languages for XR
programming-languages-for-xr
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
TypeScript in_db
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
pytest in_db
Testing and Quality Assurance
testing-and-quality-assurance
Existing dimension (library) · Role↔dimension saved
Django in_db
Frameworks & Libraries
frameworks-libraries
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
Django in_db
Web Application Frameworks
web-application-frameworks
Existing dimension (library) · Role↔dimension saved
JavaScript in_db
Cross-Platform App Languages
cross-platform-app-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
JavaScript and TypeScript
javascript-and-typescript
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
JavaScript for WordPress
javascript-for-wordpress
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
Pega Programming Languages & DSLs
pega-programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
Programming Languages
programming-languages
Existing dimension (library) · Role↔dimension saved
JavaScript in_db
Programming Languages & DSLs
programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
Programming Languages & Template Languages
programming-languages-template-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
JavaScript in_db
Storefront JavaScript and DOM Behavior
storefront-javascript-and-dom-behavior
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
HTML in_db
Pega Programming Languages & DSLs
pega-programming-languages-dsls
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
HTML in_db
Programming Languages & Template Languages
programming-languages-template-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
HTML in_db
React Frontend Development
d_init_01
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
HTML in_db
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CSS in_db
CSS Architecture and Styling
css-architecture-and-styling
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CSS in_db
Programming Languages & Template Languages
programming-languages-template-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CSS in_db
Sitecore Development Languages
sitecore-development-languages
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CSS in_db
Storefront Styling and Responsive Layout
storefront-styling-and-responsive-layout
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
CSS in_db
Styling and Responsive Layout
styling-and-responsive-layout
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
DevOps in_db
CI/CD Pipeline Platforms
ci-cd-pipeline-platforms
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
DevOps in_db
Deployment and Release Patterns
deployment-and-release-patterns
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
DevOps in_db
Infrastructure as Code
infrastructure-as-code
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)
API in_db
API Integration and Data Fetching
api-integration-and-data-fetching
Existing dimension (library) · Role↔dimension skipped (dimension not under chosen role)

Library artifacts (this run)

Kind Detail DB id
canonical_skill_proposed Perforce | type=Version Control Systems subtype=general nature=TOOL lifespan=MULTI_YEAR
canonical_skill_proposed SVN | type=Version Control Systems subtype=general nature=TOOL lifespan=MULTI_YEAR
nano JD Parser — gpt-4.1-nano click to toggle
RolePython Developer
Experience4-6 years of proven expertise
DomainIT Services & Consulting
JD type pass
Show raw JSON
{
  "JD_type": "pass",
  "about_company": null,
  "certifications": [],
  "company_name": null,
  "ctc": null,
  "domain": {
    "primary": {
      "aliases": [],
      "domain": "IT Services \u0026 Consulting"
    },
    "secondary": null
  },
  "education": null,
  "experience": {
    "max": 6,
    "min": 4,
    "raw": "4-6 years of proven expertise"
  },
  "job_locations": [],
  "role": "Python Developer",
  "role_aliases": [
    "Software Engineer",
    "Backend Developer",
    "Python Engineer"
  ],
  "role_archetype": "Engineering",
  "roles_and_responsibilities": [
    {
      "bullet_count": 0,
      "heading": "Key responsibilities",
      "heading_was_present": true,
      "source_marker": {
        "first_5_words": "collaborating in an Agile team,",
        "last_5_words": "quality code, and providing technical"
      },
      "text": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
      "word_count": 24
    },
    {
      "bullet_count": 0,
      "heading": "Skills",
      "heading_was_present": true,
      "source_marker": {
        "first_5_words": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
        "last_5_words": "devops,api"
      },
      "text": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
      "word_count": 16
    }
  ],
  "urls": []
}
API 1 — extract-from-jd click to toggle
{
  "final_skills": [
    {
      "is_primary": true,
      "skill_name": "Python"
    },
    {
      "is_primary": true,
      "skill_name": "FastAPI"
    },
    {
      "is_primary": true,
      "skill_name": "React"
    },
    {
      "is_primary": true,
      "skill_name": "Agile"
    },
    {
      "is_primary": true,
      "skill_name": "Git"
    },
    {
      "is_primary": true,
      "skill_name": "Perforce"
    },
    {
      "is_primary": true,
      "skill_name": "CI/CD"
    },
    {
      "is_primary": true,
      "skill_name": "TypeScript"
    },
    {
      "is_primary": true,
      "skill_name": "pytest"
    },
    {
      "is_primary": true,
      "skill_name": "Django"
    },
    {
      "is_primary": true,
      "skill_name": "JavaScript"
    },
    {
      "is_primary": true,
      "skill_name": "HTML"
    },
    {
      "is_primary": true,
      "skill_name": "CSS"
    },
    {
      "is_primary": true,
      "skill_name": "SVN"
    },
    {
      "is_primary": true,
      "skill_name": "DevOps"
    },
    {
      "is_primary": true,
      "skill_name": "API"
    }
  ],
  "jd_role": {
    "display_name": "Python Developer",
    "rationale": null,
    "role_aliases": [
      "Software Engineer",
      "Backend Developer",
      "Python Engineer"
    ],
    "role_archetype": "Engineering",
    "slug": ""
  },
  "nano_parsed": {
    "JD_type": "pass",
    "about_company": null,
    "certifications": [],
    "company_name": null,
    "ctc": null,
    "domain": {
      "primary": {
        "aliases": [],
        "domain": "IT Services \u0026 Consulting"
      },
      "secondary": null
    },
    "education": null,
    "experience": {
      "max": 6,
      "min": 4,
      "raw": "4-6 years of proven expertise"
    },
    "job_locations": [],
    "role": "Python Developer",
    "role_aliases": [
      "Software Engineer",
      "Backend Developer",
      "Python Engineer"
    ],
    "role_archetype": "Engineering",
    "roles_and_responsibilities": [
      {
        "bullet_count": 0,
        "heading": "Key responsibilities",
        "heading_was_present": true,
        "source_marker": {
          "first_5_words": "collaborating in an Agile team,",
          "last_5_words": "quality code, and providing technical"
        },
        "text": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
        "word_count": 24
      },
      {
        "bullet_count": 0,
        "heading": "Skills",
        "heading_was_present": true,
        "source_marker": {
          "first_5_words": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
          "last_5_words": "devops,api"
        },
        "text": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
        "word_count": 16
      }
    ],
    "urls": []
  },
  "rejected": false,
  "rejection_reason": null,
  "run_id": "2243157d-c955-4348-be07-5c5aefb33766",
  "stage3_signals": {
    "alias_found": true,
    "alias_match_roles": [
      {
        "display_name": "Backend Developer",
        "kra_matches": null,
        "matched_count": null,
        "matched_skills": null,
        "role_id": 1,
        "score": 1.0,
        "slug": "backend-engineer",
        "total_count": null
      },
      {
        "display_name": "Python Backend Developer",
        "kra_matches": null,
        "matched_count": null,
        "matched_skills": null,
        "role_id": 80,
        "score": 1.0,
        "slug": "python-backend-developer",
        "total_count": null
      }
    ],
    "kra_match_roles": [
      {
        "display_name": "Flutter Developer",
        "kra_matches": [
          {
            "kra_text": "collaborate with design, product, and backend teams",
            "sentence": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
            "similarity": 0.5984
          },
          {
            "kra_text": "collaborate with design, product, and backend teams",
            "sentence": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
            "similarity": 0.4305
          }
        ],
        "matched_count": null,
        "matched_skills": null,
        "role_id": 74,
        "score": 0.5145,
        "slug": "flutter-developer",
        "total_count": null
      },
      {
        "display_name": "Fullstack Developer",
        "kra_matches": [
          {
            "kra_text": "Works closely with product managers and UX designers to translate requirements and wireframes into working software features through iterative development.",
            "sentence": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
            "similarity": 0.554
          },
          {
            "kra_text": "Builds and integrates client-side React or Vue components with server-side Node.js or Django APIs, managing bidirectional data flow across frontend and backend layers.",
            "sentence": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
            "similarity": 0.4705
          }
        ],
        "matched_count": null,
        "matched_skills": null,
        "role_id": 15,
        "score": 0.5122,
        "slug": "full-stack-engineer",
        "total_count": null
      },
      {
        "display_name": "Angular Frontend Developer",
        "kra_matches": [
          {
            "kra_text": "collaboration with design and QA",
            "sentence": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
            "similarity": 0.6162
          },
          {
            "kra_text": "code review and refactoring",
            "sentence": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
            "similarity": 0.3733
          }
        ],
        "matched_count": null,
        "matched_skills": null,
        "role_id": 90,
        "score": 0.4947,
        "slug": "angular-frontend-developer",
        "total_count": null
      },
      {
        "display_name": "Frontend Developer",
        "kra_matches": [
          {
            "kra_text": "Collaborates with UX designers to refine interaction details, animations, responsive breakpoints, and micro-interaction behavior.",
            "sentence": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
            "similarity": 0.5068
          },
          {
            "kra_text": "Builds responsive user interfaces and interactive web components using React, Vue, or Angular with TypeScript, HTML5, and modern CSS for browser-based applications.",
            "sentence": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
            "similarity": 0.4698
          }
        ],
        "matched_count": null,
        "matched_skills": null,
        "role_id": 7,
        "score": 0.4883,
        "slug": "frontend-engineer",
        "total_count": null
      },
      {
        "display_name": "DevOps Engineer",
        "kra_matches": [
          {
            "kra_text": "Collaborates with development teams to improve build processes, reduce deployment friction, containerize applications, and adopt DevOps best practices.",
            "sentence": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.",
            "similarity": 0.4848
          },
          {
            "kra_text": "Builds and maintains CI/CD pipelines using Jenkins, GitHub Actions, GitLab CI, or CircleCI to automate build, test, security scanning, and deployment workflows.",
            "sentence": "fastapi,react,agile,git,design,perforce,ci/cd,typescript,pytest,django,javascript,html,python,css,svn,problem-solving,devops,api",
            "similarity": 0.4769
          }
        ],
        "matched_count": null,
        "matched_skills": null,
        "role_id": 10,
        "score": 0.4809,
        "slug": "devops-engineer",
        "total_count": null
      }
    ],
    "skill_match_roles": [
      {
        "display_name": "Fullstack Developer",
        "kra_matches": null,
        "matched_count": 8,
        "matched_skills": [
          "API",
          "CSS",
          "Django",
          "FastAPI",
          "JavaScript",
          "Python",
          "React",
          "TypeScript"
        ],
        "role_id": 15,
        "score": 0.5,
        "slug": "full-stack-engineer",
        "total_count": 16
      },
      {
        "display_name": "Fullstack Developer",
        "kra_matches": null,
        "matched_count": 7,
        "matched_skills": [
          "CSS",
          "Django",
          "FastAPI",
          "JavaScript",
          "Python",
          "React",
          "TypeScript"
        ],
        "role_id": 435,
        "score": 0.4375,
        "slug": "fullstack-developer",
        "total_count": 16
      },
      {
        "display_name": "Backend Developer",
        "kra_matches": null,
        "matched_count": 6,
        "matched_skills": [
          "Django",
          "FastAPI",
          "JavaScript",
          "Python",
          "TypeScript",
          "pytest"
        ],
        "role_id": 1,
        "score": 0.375,
        "slug": "backend-engineer",
        "total_count": 16
      },
      {
        "display_name": "Frontend Developer",
        "kra_matches": null,
        "matched_count": 5,
        "matched_skills": [
          "API",
          "CSS",
          "JavaScript",
          "React",
          "TypeScript"
        ],
        "role_id": 7,
        "score": 0.3125,
        "slug": "frontend-engineer",
        "total_count": 16
      },
      {
        "display_name": "Web Developer",
        "kra_matches": null,
        "matched_count": 5,
        "matched_skills": [
          "API",
          "CSS",
          "JavaScript",
          "React",
          "TypeScript"
        ],
        "role_id": 25,
        "score": 0.3125,
        "slug": "web-developer",
        "total_count": 16
      }
    ]
  },
  "stage4_decision": {
    "alias_collision_detected": false,
    "case": "DOMAIN",
    "chosen_role": {
      "display_name": "Backend Developer",
      "kra_matches": null,
      "matched_count": null,
      "matched_skills": null,
      "role_id": 1,
      "score": 0.95,
      "slug": "backend-engineer",
      "total_count": null
    },
    "confidence": 0.95,
    "is_new_role": false,
    "llm2_fired": false,
    "llm2_reasoning": null,
    "matched_dimensions": [
      "Backend Application Development",
      "API Development",
      "Agile Collaboration",
      "Technical Design and Support",
      "Quality Code Delivery",
      "DevOps and CI/CD Practices"
    ],
    "matched_kras": [
      "collaborating in an Agile team",
      "understanding client requirements",
      "developing detailed design plans",
      "writing quality code",
      "providing technical support"
    ],
    "matched_skills": [
      "Python",
      "fastapi",
      "django",
      "api",
      "pytest",
      "git",
      "ci/cd",
      "devops",
      "agile",
      "javascript",
      "typescript",
      "react",
      "html",
      "css",
      "svn",
      "perforce"
    ],
    "new_role_display_name": null,
    "new_role_slug": null,
    "queued": false,
    "reasoning": "Domain=Software Engineering \u2192 sub-role python-backend-developer; The JD centers on Python-based application development with FastAPI/Django, APIs, CI/CD, and technical support, which best matches a backend developer role.",
    "sub_role": {
      "confidence": 0.99,
      "display_name": "Python Backend Developer",
      "reasoning": "The JD explicitly centers on Python and mentions Python backend frameworks FastAPI and Django, which clearly matches Python Backend Developer.",
      "role_id": 80,
      "slug": "python-backend-developer"
    }
  },
  "stage5_updates": {
    "centroid_n_after": 779,
    "centroid_updated": true,
    "collision_log_id": null,
    "new_kra_attached": {
      "best_kra_similarity": 0.0,
      "queue_id": 833,
      "r_and_r_preview": "collaborating in an Agile team, understanding client requirements, developing detailed design plans, writing quality code, and providing technical support.\n\nfastapi,react,agile,git,design,perforce,ci/",
      "role_display_name": "Backend Developer",
      "role_slug": "backend-engineer",
      "status": "pending"
    },
    "new_skills_attached": [
      {
        "is_primary": true,
        "queue_id": 12292,
        "role_display_name": "Backend Developer",
        "role_slug": "backend-engineer",
        "skill_name": "Perforce",
        "status": "pending"
      },
      {
        "is_primary": true,
        "queue_id": 12293,
        "role_display_name": "Backend Developer",
        "role_slug": "backend-engineer",
        "skill_name": "SVN",
        "status": "pending"
      }
    ],
    "queue_entry_id": null,
    "v3_pipeline_triggered": false,
    "v3_role_slug": null,
    "v3_run_id": null
  }
}
API 2 — extract-details
{
  "alias_matches": [
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 67,
      "existing_alias_text": "Python",
      "input_term": "Python",
      "matched_canonical": {
        "category_id": 6,
        "display_name": "Python",
        "id": 5,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "python",
        "sub_category_id": 96,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1837,
      "existing_alias_text": "FastAPI",
      "input_term": "FastAPI",
      "matched_canonical": {
        "category_id": 5,
        "display_name": "FastAPI",
        "id": 1201,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "FRAMEWORK",
        "slug": "fastapi",
        "sub_category_id": 35,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1047,
      "existing_alias_text": "React",
      "input_term": "React",
      "matched_canonical": {
        "category_id": 5,
        "display_name": "React",
        "id": 610,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "FRAMEWORK",
        "slug": "react",
        "sub_category_id": 1072,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 868,
      "existing_alias_text": "Agile",
      "input_term": "Agile",
      "matched_canonical": {
        "category_id": 8,
        "display_name": "Agile",
        "id": 520,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "METHODOLOGY",
        "slug": "agile",
        "sub_category_id": 3594,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1613,
      "existing_alias_text": "Git",
      "input_term": "Git",
      "matched_canonical": {
        "category_id": 13,
        "display_name": "Git",
        "id": 1002,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "TOOL",
        "slug": "git",
        "sub_category_id": 730,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1826,
      "existing_alias_text": "CI/CD",
      "input_term": "CI/CD",
      "matched_canonical": {
        "category_id": 8,
        "display_name": "CI/CD",
        "id": 1190,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "METHODOLOGY",
        "slug": "ci-cd",
        "sub_category_id": 900,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 914,
      "existing_alias_text": "TypeScript",
      "input_term": "TypeScript",
      "matched_canonical": {
        "category_id": 6,
        "display_name": "TypeScript",
        "id": 524,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "typescript",
        "sub_category_id": 96,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 3666,
      "existing_alias_text": "pytest",
      "input_term": "pytest",
      "matched_canonical": {
        "category_id": 13,
        "display_name": "pytest",
        "id": 2370,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "TOOL",
        "slug": "pytest",
        "sub_category_id": 513,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 82,
      "existing_alias_text": "Django",
      "input_term": "Django",
      "matched_canonical": {
        "category_id": 5,
        "display_name": "Django",
        "id": 9,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "FRAMEWORK",
        "slug": "django",
        "sub_category_id": 35,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1028,
      "existing_alias_text": "JavaScript",
      "input_term": "JavaScript",
      "matched_canonical": {
        "category_id": 6,
        "display_name": "JavaScript",
        "id": 607,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "javascript",
        "sub_category_id": 96,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 2627,
      "existing_alias_text": "HTML",
      "input_term": "HTML",
      "matched_canonical": {
        "category_id": 6,
        "display_name": "HTML",
        "id": 1657,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "html",
        "sub_category_id": 1467,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1107,
      "existing_alias_text": "CSS",
      "input_term": "CSS",
      "matched_canonical": {
        "category_id": 6,
        "display_name": "CSS",
        "id": 623,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "css",
        "sub_category_id": 486,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 1852,
      "existing_alias_text": "DevOps",
      "input_term": "DevOps",
      "matched_canonical": {
        "category_id": 8,
        "display_name": "DevOps",
        "id": 1216,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "METHODOLOGY",
        "slug": "devops",
        "sub_category_id": 922,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    },
    {
      "alias_persist_skipped_reason": "alias_text already exists for this canonical skill",
      "alias_persisted": false,
      "existing_alias_id": 2514,
      "existing_alias_text": "API",
      "input_term": "API",
      "matched_canonical": {
        "category_id": 2,
        "display_name": "API",
        "id": 1568,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "CONCEPT",
        "slug": "api",
        "sub_category_id": 1174,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "matched_via": "alias"
    }
  ],
  "candidate_roles": [
    {
      "display_name": "Cloud Security Engineer",
      "id": 23,
      "rationale": null,
      "role_archetype": null,
      "slug": "cloud-security-engineer",
      "source": "db"
    },
    {
      "display_name": "Backend Developer",
      "id": 1,
      "rationale": null,
      "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
      "slug": "backend-engineer",
      "source": "db"
    },
    {
      "display_name": "Fullstack Developer",
      "id": 15,
      "rationale": null,
      "role_archetype": null,
      "slug": "full-stack-engineer",
      "source": "db"
    },
    {
      "display_name": "Fullstack Developer",
      "id": 435,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "fullstack-developer",
      "source": "db"
    },
    {
      "display_name": "Engineering Manager",
      "id": 121,
      "rationale": null,
      "role_archetype": null,
      "slug": "engineering-manager",
      "source": "db"
    },
    {
      "display_name": "Cyber Security Engineer",
      "id": 5,
      "rationale": null,
      "role_archetype": null,
      "slug": "cybersecurity-engineer",
      "source": "db"
    },
    {
      "display_name": "Data Engineer",
      "id": 2,
      "rationale": null,
      "role_archetype": null,
      "slug": "data-engineer",
      "source": "db"
    },
    {
      "display_name": "ML Engineer",
      "id": 3,
      "rationale": null,
      "role_archetype": null,
      "slug": "ml-engineer",
      "source": "db"
    },
    {
      "display_name": "MLOps Engineer",
      "id": 16,
      "rationale": null,
      "role_archetype": null,
      "slug": "ml-ops-engineer",
      "source": "db"
    },
    {
      "display_name": "AR/VR Engineer",
      "id": 8,
      "rationale": null,
      "role_archetype": null,
      "slug": "ar-vr-engineer",
      "source": "db"
    },
    {
      "display_name": "Python Backend Developer",
      "id": 80,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "python-backend-developer",
      "source": "db"
    },
    {
      "display_name": "Java Backend Developer",
      "id": 79,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "java-backend-developer",
      "source": "db"
    },
    {
      "display_name": "Node.js Backend Developer",
      "id": 82,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "node-backend-developer",
      "source": "db"
    },
    {
      "display_name": "PHP Backend Developer",
      "id": 86,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "php-backend-developer",
      "source": "db"
    },
    {
      "display_name": "Sitecore Dev",
      "id": 233,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "sitecore-dev",
      "source": "db"
    },
    {
      "display_name": "Drupal Dev",
      "id": 228,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "drupal-dev",
      "source": "db"
    },
    {
      "display_name": "Shopify Dev",
      "id": 230,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "shopify-dev",
      "source": "db"
    },
    {
      "display_name": "WordPress Dev",
      "id": 227,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "wordpress-dev",
      "source": "db"
    },
    {
      "display_name": "React Frontend Developer",
      "id": 89,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "react-frontend-developer",
      "source": "db"
    },
    {
      "display_name": "Frontend Developer",
      "id": 7,
      "rationale": null,
      "role_archetype": null,
      "slug": "frontend-engineer",
      "source": "db"
    },
    {
      "display_name": "Hybrid Mobile Developer",
      "id": 11,
      "rationale": null,
      "role_archetype": null,
      "slug": "hybrid-mobile-developer",
      "source": "db"
    },
    {
      "display_name": "Ionic Developer",
      "id": 434,
      "rationale": null,
      "role_archetype": null,
      "slug": "ionic-developer",
      "source": "db"
    },
    {
      "display_name": "Web Developer",
      "id": 25,
      "rationale": null,
      "role_archetype": null,
      "slug": "web-developer",
      "source": "db"
    },
    {
      "display_name": "DevOps Engineer",
      "id": 10,
      "rationale": null,
      "role_archetype": null,
      "slug": "devops-engineer",
      "source": "db"
    },
    {
      "display_name": "Angular Frontend Developer",
      "id": 90,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "angular-frontend-developer",
      "source": "db"
    },
    {
      "display_name": "React Native Developer",
      "id": 73,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "react-native-developer",
      "source": "db"
    },
    {
      "display_name": "Svelte Frontend Developer",
      "id": 92,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "svelte-frontend-developer",
      "source": "db"
    },
    {
      "display_name": "Vue Frontend Developer",
      "id": 91,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "vue-frontend-developer",
      "source": "db"
    },
    {
      "display_name": ".NET Backend Developer",
      "id": 83,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "dotnet-backend-developer",
      "source": "db"
    },
    {
      "display_name": "Scala Backend Developer",
      "id": 87,
      "rationale": null,
      "role_archetype": "Engineering",
      "slug": "scala-backend-developer",
      "source": "db"
    },
    {
      "display_name": "Pega Developer",
      "id": 24,
      "rationale": null,
      "role_archetype": null,
      "slug": "pega-developer",
      "source": "db"
    },
    {
      "display_name": "Cloud Architect",
      "id": 9,
      "rationale": null,
      "role_archetype": null,
      "slug": "cloud-architect",
      "source": "db"
    }
  ],
  "chosen_role": {
    "display_name": "Backend Developer",
    "id": 1,
    "rationale": "Domain=Software Engineering \u2192 sub-role python-backend-developer; The JD centers on Python-based application development with FastAPI/Django, APIs, CI/CD, and technical support, which best matches a backend developer role.",
    "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
    "slug": "backend-engineer",
    "source": "db"
  },
  "dimensions": [
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Cloud Security Scripting \u0026 DSL Languages",
        "id": 248,
        "rationale": "Proficiency in programming and domain-specific languages used to automate and script cloud security controls.",
        "slug": "cloud-security-scripting-dsl-languages",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Cloud Security Engineer",
          "id": 23,
          "rationale": null,
          "role_archetype": null,
          "slug": "cloud-security-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages",
        "id": 1,
        "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
        "slug": "programming-languages",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Backend Developer",
          "id": 1,
          "rationale": null,
          "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
          "slug": "backend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages \u0026 DSLs",
        "id": 475,
        "rationale": "Oversee and guide the selection and effective use of programming and domain\u2010specific languages in software projects.",
        "slug": "programming-languages-dsls",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Engineering Manager",
          "id": 121,
          "rationale": null,
          "role_archetype": null,
          "slug": "engineering-manager",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages and Scripting",
        "id": 59,
        "rationale": "Languages used to write security automation, analysis scripts, detection logic, and remediation helpers. This is the primary implementation surface for a cybersecurity engineer across tooling and response workflows.",
        "slug": "programming-languages-and-scripting",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Cyber Security Engineer",
          "id": 5,
          "rationale": null,
          "role_archetype": null,
          "slug": "cybersecurity-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages for Data Work",
        "id": 21,
        "rationale": "Languages used to implement data pipelines, transformations, and operational glue. This is the primary coding surface for building ingestion, enrichment, and automation logic in data engineering.",
        "slug": "programming-languages-for-data-work",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Data Engineer",
          "id": 2,
          "rationale": null,
          "role_archetype": null,
          "slug": "data-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages for ML Systems",
        "id": 39,
        "rationale": "Languages used to build training code, inference services, evaluation jobs, and ML glue code. This is the primary implementation surface for ML engineers across experimentation and productionization.",
        "slug": "programming-languages-for-ml-systems",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "ML Engineer",
          "id": 3,
          "rationale": null,
          "role_archetype": null,
          "slug": "ml-engineer",
          "source": "db"
        },
        {
          "display_name": "MLOps Engineer",
          "id": 16,
          "rationale": null,
          "role_archetype": null,
          "slug": "ml-ops-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages for XR",
        "id": 97,
        "rationale": "Primary implementation languages used to build immersive client features, interaction logic, and device-specific runtime behavior. This is the core coding surface for AR/VR experiences.",
        "slug": "programming-languages-for-xr",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "AR/VR Engineer",
          "id": 8,
          "rationale": null,
          "role_archetype": null,
          "slug": "ar-vr-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Python Programming",
        "id": 290,
        "rationale": "Core Python language skills used to implement backend business logic, request handlers, integrations, and service internals. This is the primary coding surface for the role.",
        "slug": "python-programming",
        "source": "db"
      },
      "input_skill": "Python",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Python Backend Developer",
          "id": 80,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "python-backend-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "React Frontend Development",
        "id": 96,
        "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
        "slug": "d_init_01",
        "source": "db"
      },
      "input_skill": "FastAPI",
      "llm_role": null,
      "roles_from_db": []
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Web Application Frameworks",
        "id": 2,
        "rationale": "Server frameworks and runtimes used to build HTTP services, controllers, middleware, and request pipelines. These frameworks shape how backend endpoints are structured and delivered.",
        "slug": "web-application-frameworks",
        "source": "db"
      },
      "input_skill": "FastAPI",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Backend Developer",
          "id": 1,
          "rationale": null,
          "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
          "slug": "backend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Java Backend Developer",
          "id": 79,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "java-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Node.js Backend Developer",
          "id": 82,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "node-backend-developer",
          "source": "db"
        },
        {
          "display_name": "PHP Backend Developer",
          "id": 86,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "php-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Python Backend Developer",
          "id": 80,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "python-backend-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Application Frameworks \u0026 Libraries",
        "id": 451,
        "rationale": "Covers the primary software frameworks and libraries often used alongside Sitecore for building and enhancing site experiences.",
        "slug": "application-frameworks-libraries",
        "source": "db"
      },
      "input_skill": "React",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Sitecore Dev",
          "id": 233,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "sitecore-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Frameworks \u0026 Libraries",
        "id": 360,
        "rationale": "Manage adoption, integration, and best practices around key software frameworks and libraries.",
        "slug": "frameworks-libraries",
        "source": "db"
      },
      "input_skill": "React",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Drupal Dev",
          "id": 228,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "drupal-dev",
          "source": "db"
        },
        {
          "display_name": "Engineering Manager",
          "id": 121,
          "rationale": null,
          "role_archetype": null,
          "slug": "engineering-manager",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Frontend Frameworks and Libraries",
        "id": 434,
        "rationale": "Utilizing modern JavaScript frameworks and Shopify libraries to build dynamic and interactive storefronts.",
        "slug": "frontend-frameworks-and-libraries",
        "source": "db"
      },
      "input_skill": "React",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Shopify Dev",
          "id": 230,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "shopify-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "JavaScript for WordPress",
        "id": 329,
        "rationale": "Client-side scripting used to enhance WordPress themes, blocks, and admin/editor interactions. This includes modern JavaScript patterns as they apply to WordPress-specific behavior rather than standalone frontend applications.",
        "slug": "javascript-for-wordpress",
        "source": "db"
      },
      "input_skill": "React",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "WordPress Dev",
          "id": 227,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "wordpress-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "React Component Architecture",
        "id": 302,
        "rationale": "Building reusable React components, composing props and children, and managing rendering behavior across feature screens. This is the primary framework cluster for a React frontend developer.",
        "slug": "react-component-architecture",
        "source": "db"
      },
      "input_skill": "React",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "React Frontend Developer",
          "id": 89,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-frontend-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "UI Frameworks and Rendering",
        "id": 115,
        "rationale": "Component frameworks and rendering models used to build browser screens, reusable UI, and interactive client flows. This is a core cluster because frontend engineers spend much of their time composing and updating view hierarchies.",
        "slug": "ui-frameworks-and-rendering",
        "source": "db"
      },
      "input_skill": "React",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Frontend Developer",
          "id": 7,
          "rationale": null,
          "role_archetype": null,
          "slug": "frontend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        },
        {
          "display_name": "Hybrid Mobile Developer",
          "id": 11,
          "rationale": null,
          "role_archetype": null,
          "slug": "hybrid-mobile-developer",
          "source": "db"
        },
        {
          "display_name": "Ionic Developer",
          "id": 434,
          "rationale": null,
          "role_archetype": null,
          "slug": "ionic-developer",
          "source": "db"
        },
        {
          "display_name": "Web Developer",
          "id": 25,
          "rationale": null,
          "role_archetype": null,
          "slug": "web-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "React Frontend Development",
        "id": 96,
        "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
        "slug": "d_init_01",
        "source": "db"
      },
      "input_skill": "Agile",
      "llm_role": null,
      "roles_from_db": []
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Software Concepts, Patterns \u0026 Practices",
        "id": 478,
        "rationale": "Champion foundational software design patterns, development methodologies, and engineering best practices.",
        "slug": "software-concepts-patterns-practices",
        "source": "db"
      },
      "input_skill": "Agile",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Engineering Manager",
          "id": 121,
          "rationale": null,
          "role_archetype": null,
          "slug": "engineering-manager",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "React Frontend Development",
        "id": 96,
        "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
        "slug": "d_init_01",
        "source": "db"
      },
      "input_skill": "Git",
      "llm_role": null,
      "roles_from_db": []
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "CI/CD Pipeline Platforms",
        "id": 150,
        "rationale": "Systems used to define, run, and maintain automated build and deployment workflows. This cluster is coherent because the role owns delivery automation end to end, including pipeline reliability and promotion logic.",
        "slug": "ci-cd-pipeline-platforms",
        "source": "db"
      },
      "input_skill": "CI/CD",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "DevOps Engineer",
          "id": 10,
          "rationale": null,
          "role_archetype": null,
          "slug": "devops-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "CI/CD for Machine Learning",
        "id": 56,
        "rationale": "Tools and platforms for automating ML model integration, testing, and deployment pipelines.",
        "slug": "ci-cd-for-machine-learning",
        "source": "db"
      },
      "input_skill": "CI/CD",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "ML Engineer",
          "id": 3,
          "rationale": null,
          "role_archetype": null,
          "slug": "ml-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Cross-Platform App Languages",
        "id": 167,
        "rationale": "Languages used to implement shared mobile features across iOS and Android from a common codebase. This is the primary coding surface for hybrid app logic, UI behavior, and platform-specific branching.",
        "slug": "cross-platform-app-languages",
        "source": "db"
      },
      "input_skill": "TypeScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Hybrid Mobile Developer",
          "id": 11,
          "rationale": null,
          "role_archetype": null,
          "slug": "hybrid-mobile-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "JavaScript and TypeScript",
        "id": 114,
        "rationale": "Primary implementation languages for browser client code, UI logic, and shared frontend utilities. These languages are the main coding surface for building interactive web experiences in this role.",
        "slug": "javascript-and-typescript",
        "source": "db"
      },
      "input_skill": "TypeScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Angular Frontend Developer",
          "id": 90,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "angular-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Frontend Developer",
          "id": 7,
          "rationale": null,
          "role_archetype": null,
          "slug": "frontend-engineer",
          "source": "db"
        },
        {
          "display_name": "Ionic Developer",
          "id": 434,
          "rationale": null,
          "role_archetype": null,
          "slug": "ionic-developer",
          "source": "db"
        },
        {
          "display_name": "Node.js Backend Developer",
          "id": 82,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "node-backend-developer",
          "source": "db"
        },
        {
          "display_name": "React Frontend Developer",
          "id": 89,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "React Native Developer",
          "id": 73,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-native-developer",
          "source": "db"
        },
        {
          "display_name": "Svelte Frontend Developer",
          "id": 92,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "svelte-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Vue Frontend Developer",
          "id": 91,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "vue-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Web Developer",
          "id": 25,
          "rationale": null,
          "role_archetype": null,
          "slug": "web-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages",
        "id": 1,
        "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
        "slug": "programming-languages",
        "source": "db"
      },
      "input_skill": "TypeScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Backend Developer",
          "id": 1,
          "rationale": null,
          "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
          "slug": "backend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages for XR",
        "id": 97,
        "rationale": "Primary implementation languages used to build immersive client features, interaction logic, and device-specific runtime behavior. This is the core coding surface for AR/VR experiences.",
        "slug": "programming-languages-for-xr",
        "source": "db"
      },
      "input_skill": "TypeScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "AR/VR Engineer",
          "id": 8,
          "rationale": null,
          "role_archetype": null,
          "slug": "ar-vr-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Sitecore Development Languages",
        "id": 438,
        "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
        "slug": "sitecore-development-languages",
        "source": "db"
      },
      "input_skill": "TypeScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Sitecore Dev",
          "id": 233,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "sitecore-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Testing and Quality Assurance",
        "id": 12,
        "rationale": "Backend-specific test strategies used to validate service behavior and integration points. Covers automated test layers, contract checks, fixtures, and regression prevention.",
        "slug": "testing-and-quality-assurance",
        "source": "db"
      },
      "input_skill": "pytest",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": ".NET Backend Developer",
          "id": 83,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "dotnet-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Backend Developer",
          "id": 1,
          "rationale": null,
          "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
          "slug": "backend-engineer",
          "source": "db"
        },
        {
          "display_name": "Node.js Backend Developer",
          "id": 82,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "node-backend-developer",
          "source": "db"
        },
        {
          "display_name": "PHP Backend Developer",
          "id": 86,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "php-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Python Backend Developer",
          "id": 80,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "python-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Scala Backend Developer",
          "id": 87,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "scala-backend-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Frameworks \u0026 Libraries",
        "id": 360,
        "rationale": "Manage adoption, integration, and best practices around key software frameworks and libraries.",
        "slug": "frameworks-libraries",
        "source": "db"
      },
      "input_skill": "Django",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Drupal Dev",
          "id": 228,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "drupal-dev",
          "source": "db"
        },
        {
          "display_name": "Engineering Manager",
          "id": 121,
          "rationale": null,
          "role_archetype": null,
          "slug": "engineering-manager",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Web Application Frameworks",
        "id": 2,
        "rationale": "Server frameworks and runtimes used to build HTTP services, controllers, middleware, and request pipelines. These frameworks shape how backend endpoints are structured and delivered.",
        "slug": "web-application-frameworks",
        "source": "db"
      },
      "input_skill": "Django",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Backend Developer",
          "id": 1,
          "rationale": null,
          "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
          "slug": "backend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Java Backend Developer",
          "id": 79,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "java-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Node.js Backend Developer",
          "id": 82,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "node-backend-developer",
          "source": "db"
        },
        {
          "display_name": "PHP Backend Developer",
          "id": 86,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "php-backend-developer",
          "source": "db"
        },
        {
          "display_name": "Python Backend Developer",
          "id": 80,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "python-backend-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Cross-Platform App Languages",
        "id": 167,
        "rationale": "Languages used to implement shared mobile features across iOS and Android from a common codebase. This is the primary coding surface for hybrid app logic, UI behavior, and platform-specific branching.",
        "slug": "cross-platform-app-languages",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Hybrid Mobile Developer",
          "id": 11,
          "rationale": null,
          "role_archetype": null,
          "slug": "hybrid-mobile-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "JavaScript and TypeScript",
        "id": 114,
        "rationale": "Primary implementation languages for browser client code, UI logic, and shared frontend utilities. These languages are the main coding surface for building interactive web experiences in this role.",
        "slug": "javascript-and-typescript",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Angular Frontend Developer",
          "id": 90,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "angular-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Frontend Developer",
          "id": 7,
          "rationale": null,
          "role_archetype": null,
          "slug": "frontend-engineer",
          "source": "db"
        },
        {
          "display_name": "Ionic Developer",
          "id": 434,
          "rationale": null,
          "role_archetype": null,
          "slug": "ionic-developer",
          "source": "db"
        },
        {
          "display_name": "Node.js Backend Developer",
          "id": 82,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "node-backend-developer",
          "source": "db"
        },
        {
          "display_name": "React Frontend Developer",
          "id": 89,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "React Native Developer",
          "id": 73,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-native-developer",
          "source": "db"
        },
        {
          "display_name": "Svelte Frontend Developer",
          "id": 92,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "svelte-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Vue Frontend Developer",
          "id": 91,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "vue-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Web Developer",
          "id": 25,
          "rationale": null,
          "role_archetype": null,
          "slug": "web-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "JavaScript for WordPress",
        "id": 329,
        "rationale": "Client-side scripting used to enhance WordPress themes, blocks, and admin/editor interactions. This includes modern JavaScript patterns as they apply to WordPress-specific behavior rather than standalone frontend applications.",
        "slug": "javascript-for-wordpress",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "WordPress Dev",
          "id": 227,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "wordpress-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Pega Programming Languages \u0026 DSLs",
        "id": 267,
        "rationale": "Programming languages and domain-specific languages used in Pega development.",
        "slug": "pega-programming-languages-dsls",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Pega Developer",
          "id": 24,
          "rationale": null,
          "role_archetype": null,
          "slug": "pega-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages",
        "id": 1,
        "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
        "slug": "programming-languages",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Backend Developer",
          "id": 1,
          "rationale": null,
          "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
          "slug": "backend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages \u0026 DSLs",
        "id": 475,
        "rationale": "Oversee and guide the selection and effective use of programming and domain\u2010specific languages in software projects.",
        "slug": "programming-languages-dsls",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Engineering Manager",
          "id": 121,
          "rationale": null,
          "role_archetype": null,
          "slug": "engineering-manager",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages \u0026 Template Languages",
        "id": 359,
        "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
        "slug": "programming-languages-template-languages",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Drupal Dev",
          "id": 228,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "drupal-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Sitecore Development Languages",
        "id": 438,
        "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
        "slug": "sitecore-development-languages",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Sitecore Dev",
          "id": 233,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "sitecore-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Storefront JavaScript and DOM Behavior",
        "id": 422,
        "rationale": "Client-side behavior used to enhance Shopify storefront interactions beyond static theme rendering. This includes interactive UI logic, event handling, and progressive enhancement within theme constraints.",
        "slug": "storefront-javascript-and-dom-behavior",
        "source": "db"
      },
      "input_skill": "JavaScript",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Shopify Dev",
          "id": 230,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "shopify-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Pega Programming Languages \u0026 DSLs",
        "id": 267,
        "rationale": "Programming languages and domain-specific languages used in Pega development.",
        "slug": "pega-programming-languages-dsls",
        "source": "db"
      },
      "input_skill": "HTML",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Pega Developer",
          "id": 24,
          "rationale": null,
          "role_archetype": null,
          "slug": "pega-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages \u0026 Template Languages",
        "id": 359,
        "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
        "slug": "programming-languages-template-languages",
        "source": "db"
      },
      "input_skill": "HTML",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Drupal Dev",
          "id": 228,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "drupal-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "React Frontend Development",
        "id": 96,
        "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
        "slug": "d_init_01",
        "source": "db"
      },
      "input_skill": "HTML",
      "llm_role": null,
      "roles_from_db": []
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Sitecore Development Languages",
        "id": 438,
        "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
        "slug": "sitecore-development-languages",
        "source": "db"
      },
      "input_skill": "HTML",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Sitecore Dev",
          "id": 233,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "sitecore-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "CSS Architecture and Styling",
        "id": 117,
        "rationale": "Styling systems and layout techniques used to create responsive, maintainable visual presentation in the browser. Frontend engineers need this to translate design intent into consistent interfaces.",
        "slug": "css-architecture-and-styling",
        "source": "db"
      },
      "input_skill": "CSS",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Frontend Developer",
          "id": 7,
          "rationale": null,
          "role_archetype": null,
          "slug": "frontend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 435,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "fullstack-developer",
          "source": "db"
        },
        {
          "display_name": "React Frontend Developer",
          "id": 89,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Svelte Frontend Developer",
          "id": 92,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "svelte-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Vue Frontend Developer",
          "id": 91,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "vue-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Web Developer",
          "id": 25,
          "rationale": null,
          "role_archetype": null,
          "slug": "web-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Programming Languages \u0026 Template Languages",
        "id": 359,
        "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
        "slug": "programming-languages-template-languages",
        "source": "db"
      },
      "input_skill": "CSS",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Drupal Dev",
          "id": 228,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "drupal-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Sitecore Development Languages",
        "id": 438,
        "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
        "slug": "sitecore-development-languages",
        "source": "db"
      },
      "input_skill": "CSS",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Sitecore Dev",
          "id": 233,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "sitecore-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Storefront Styling and Responsive Layout",
        "id": 423,
        "rationale": "Visual presentation work for Shopify storefronts, including layout, spacing, typography, and responsive behavior. This is a coherent cluster because theme developers must translate commerce designs into usable storefront pages.",
        "slug": "storefront-styling-and-responsive-layout",
        "source": "db"
      },
      "input_skill": "CSS",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Shopify Dev",
          "id": 230,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "shopify-dev",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Styling and Responsive Layout",
        "id": 307,
        "rationale": "Visual presentation techniques used to translate design requirements into usable Angular interfaces. This includes layout, theming, spacing, and responsive behavior across screen sizes.",
        "slug": "styling-and-responsive-layout",
        "source": "db"
      },
      "input_skill": "CSS",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Angular Frontend Developer",
          "id": 90,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "angular-frontend-developer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "CI/CD Pipeline Platforms",
        "id": 150,
        "rationale": "Systems used to define, run, and maintain automated build and deployment workflows. This cluster is coherent because the role owns delivery automation end to end, including pipeline reliability and promotion logic.",
        "slug": "ci-cd-pipeline-platforms",
        "source": "db"
      },
      "input_skill": "DevOps",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "DevOps Engineer",
          "id": 10,
          "rationale": null,
          "role_archetype": null,
          "slug": "devops-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Deployment and Release Patterns",
        "id": 140,
        "rationale": "Patterns for promoting changes safely across environments, including rollout, rollback, and release gating strategies. Cloud Architects define these patterns so teams can deploy consistently across the platform.",
        "slug": "deployment-and-release-patterns",
        "source": "db"
      },
      "input_skill": "DevOps",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Cloud Architect",
          "id": 9,
          "rationale": null,
          "role_archetype": null,
          "slug": "cloud-architect",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "Infrastructure as Code",
        "id": 132,
        "rationale": "Declarative provisioning and environment definition tools used to codify cloud infrastructure, repeatable environments, and platform standards. Cloud Architects use these to express reference architectures and guardrails.",
        "slug": "infrastructure-as-code",
        "source": "db"
      },
      "input_skill": "DevOps",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Cloud Architect",
          "id": 9,
          "rationale": null,
          "role_archetype": null,
          "slug": "cloud-architect",
          "source": "db"
        },
        {
          "display_name": "DevOps Engineer",
          "id": 10,
          "rationale": null,
          "role_archetype": null,
          "slug": "devops-engineer",
          "source": "db"
        }
      ]
    },
    {
      "dimension": {
        "difficulty_hint": "well_known",
        "display_name": "API Integration and Data Fetching",
        "id": 127,
        "rationale": "Client-side integration with backend endpoints and third-party services, including request shaping, response handling, and synchronization with UI state. This is central to frontend work because most screens depend on remote data.",
        "slug": "api-integration-and-data-fetching",
        "source": "db"
      },
      "input_skill": "API",
      "llm_role": null,
      "roles_from_db": [
        {
          "display_name": "Angular Frontend Developer",
          "id": 90,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "angular-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Frontend Developer",
          "id": 7,
          "rationale": null,
          "role_archetype": null,
          "slug": "frontend-engineer",
          "source": "db"
        },
        {
          "display_name": "Fullstack Developer",
          "id": 15,
          "rationale": null,
          "role_archetype": null,
          "slug": "full-stack-engineer",
          "source": "db"
        },
        {
          "display_name": "React Frontend Developer",
          "id": 89,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "react-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Svelte Frontend Developer",
          "id": 92,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "svelte-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Vue Frontend Developer",
          "id": 91,
          "rationale": null,
          "role_archetype": "Engineering",
          "slug": "vue-frontend-developer",
          "source": "db"
        },
        {
          "display_name": "Web Developer",
          "id": 25,
          "rationale": null,
          "role_archetype": null,
          "slug": "web-developer",
          "source": "db"
        }
      ]
    }
  ],
  "input_final_skills": [
    "Python",
    "FastAPI",
    "React",
    "Agile",
    "Git",
    "Perforce",
    "CI/CD",
    "TypeScript",
    "pytest",
    "Django",
    "JavaScript",
    "HTML",
    "CSS",
    "SVN",
    "DevOps",
    "API"
  ],
  "input_llm_skills": [
    "Python",
    "FastAPI",
    "React",
    "Agile",
    "Git",
    "Perforce",
    "CI/CD",
    "TypeScript",
    "pytest",
    "Django",
    "JavaScript",
    "HTML",
    "CSS",
    "SVN",
    "DevOps",
    "API"
  ],
  "new_aliases_persisted": 0,
  "run_id": "2243157d-c955-4348-be07-5c5aefb33766",
  "skills_detail": [
    {
      "aliases_in_db": [
        {
          "alias_text": "Python",
          "alias_type": "CANONICAL",
          "id": 67,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 2",
          "alias_type": "VERSION",
          "id": 72,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 2.x",
          "alias_type": "VERSION",
          "id": 74,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 3",
          "alias_type": "VERSION",
          "id": 73,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 3.10",
          "alias_type": "VERSION",
          "id": 76,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 3.11",
          "alias_type": "VERSION",
          "id": 77,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 3.12",
          "alias_type": "VERSION",
          "id": 78,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Python 3.x",
          "alias_type": "VERSION",
          "id": 75,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "py",
          "alias_type": "VERSION",
          "id": 2183,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "py2",
          "alias_type": "VERSION",
          "id": 68,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "py3",
          "alias_type": "VERSION",
          "id": 69,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "python 3",
          "alias_type": "VERSION",
          "id": 2186,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "python 3.x",
          "alias_type": "VERSION",
          "id": 2849,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "python2",
          "alias_type": "VERSION",
          "id": 70,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "python3",
          "alias_type": "VERSION",
          "id": 71,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "python3.x",
          "alias_type": "VERSION",
          "id": 2848,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 6,
        "display_name": "Python",
        "id": 5,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "python",
        "sub_category_id": 96,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Cloud Security Scripting \u0026 DSL Languages",
            "id": 248,
            "rationale": "Proficiency in programming and domain-specific languages used to automate and script cloud security controls.",
            "slug": "cloud-security-scripting-dsl-languages",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Cloud Security Engineer",
              "id": 23,
              "rationale": null,
              "role_archetype": null,
              "slug": "cloud-security-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages",
            "id": 1,
            "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
            "slug": "programming-languages",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Backend Developer",
              "id": 1,
              "rationale": null,
              "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
              "slug": "backend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages \u0026 DSLs",
            "id": 475,
            "rationale": "Oversee and guide the selection and effective use of programming and domain\u2010specific languages in software projects.",
            "slug": "programming-languages-dsls",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Engineering Manager",
              "id": 121,
              "rationale": null,
              "role_archetype": null,
              "slug": "engineering-manager",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages and Scripting",
            "id": 59,
            "rationale": "Languages used to write security automation, analysis scripts, detection logic, and remediation helpers. This is the primary implementation surface for a cybersecurity engineer across tooling and response workflows.",
            "slug": "programming-languages-and-scripting",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Cyber Security Engineer",
              "id": 5,
              "rationale": null,
              "role_archetype": null,
              "slug": "cybersecurity-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages for Data Work",
            "id": 21,
            "rationale": "Languages used to implement data pipelines, transformations, and operational glue. This is the primary coding surface for building ingestion, enrichment, and automation logic in data engineering.",
            "slug": "programming-languages-for-data-work",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Data Engineer",
              "id": 2,
              "rationale": null,
              "role_archetype": null,
              "slug": "data-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages for ML Systems",
            "id": 39,
            "rationale": "Languages used to build training code, inference services, evaluation jobs, and ML glue code. This is the primary implementation surface for ML engineers across experimentation and productionization.",
            "slug": "programming-languages-for-ml-systems",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "ML Engineer",
              "id": 3,
              "rationale": null,
              "role_archetype": null,
              "slug": "ml-engineer",
              "source": "db"
            },
            {
              "display_name": "MLOps Engineer",
              "id": 16,
              "rationale": null,
              "role_archetype": null,
              "slug": "ml-ops-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages for XR",
            "id": 97,
            "rationale": "Primary implementation languages used to build immersive client features, interaction logic, and device-specific runtime behavior. This is the core coding surface for AR/VR experiences.",
            "slug": "programming-languages-for-xr",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "AR/VR Engineer",
              "id": 8,
              "rationale": null,
              "role_archetype": null,
              "slug": "ar-vr-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Python Programming",
            "id": 290,
            "rationale": "Core Python language skills used to implement backend business logic, request handlers, integrations, and service internals. This is the primary coding surface for the role.",
            "slug": "python-programming",
            "source": "db"
          },
          "input_skill": "Python",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Python Backend Developer",
              "id": 80,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "python-backend-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "Python",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "FastAPI",
          "alias_type": "CANONICAL",
          "id": 1837,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 5,
        "display_name": "FastAPI",
        "id": 1201,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "FRAMEWORK",
        "slug": "fastapi",
        "sub_category_id": 35,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "React Frontend Development",
            "id": 96,
            "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
            "slug": "d_init_01",
            "source": "db"
          },
          "input_skill": "FastAPI",
          "llm_role": null,
          "roles_from_db": []
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Web Application Frameworks",
            "id": 2,
            "rationale": "Server frameworks and runtimes used to build HTTP services, controllers, middleware, and request pipelines. These frameworks shape how backend endpoints are structured and delivered.",
            "slug": "web-application-frameworks",
            "source": "db"
          },
          "input_skill": "FastAPI",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Backend Developer",
              "id": 1,
              "rationale": null,
              "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
              "slug": "backend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Java Backend Developer",
              "id": 79,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "java-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Node.js Backend Developer",
              "id": 82,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "node-backend-developer",
              "source": "db"
            },
            {
              "display_name": "PHP Backend Developer",
              "id": 86,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "php-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Python Backend Developer",
              "id": 80,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "python-backend-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "FastAPI",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "React",
          "alias_type": "CANONICAL",
          "id": 1047,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 0.13",
          "alias_type": "VERSION",
          "id": 1052,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 0.14",
          "alias_type": "VERSION",
          "id": 1053,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 15",
          "alias_type": "VERSION",
          "id": 1048,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 15.x",
          "alias_type": "VERSION",
          "id": 1054,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 16",
          "alias_type": "VERSION",
          "id": 1049,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 16.x",
          "alias_type": "VERSION",
          "id": 1055,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 17",
          "alias_type": "VERSION",
          "id": 1050,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 17.x",
          "alias_type": "VERSION",
          "id": 1056,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 18",
          "alias_type": "VERSION",
          "id": 1051,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 18.x",
          "alias_type": "VERSION",
          "id": 1057,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React 19",
          "alias_type": "VERSION",
          "id": 2068,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React v15",
          "alias_type": "VERSION",
          "id": 3185,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React v16",
          "alias_type": "VERSION",
          "id": 3186,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React v17",
          "alias_type": "VERSION",
          "id": 3187,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React v18",
          "alias_type": "VERSION",
          "id": 3188,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "React v19",
          "alias_type": "VERSION",
          "id": 6510,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ReactJS 18",
          "alias_type": "VERSION",
          "id": 2074,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react 15",
          "alias_type": "VERSION",
          "id": 2069,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react 16",
          "alias_type": "VERSION",
          "id": 2070,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react 17",
          "alias_type": "VERSION",
          "id": 2071,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react 18",
          "alias_type": "VERSION",
          "id": 2072,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react 19",
          "alias_type": "VERSION",
          "id": 2073,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react15",
          "alias_type": "VERSION",
          "id": 3177,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react16",
          "alias_type": "VERSION",
          "id": 3178,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react17",
          "alias_type": "VERSION",
          "id": 3179,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react18",
          "alias_type": "VERSION",
          "id": 3180,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "react19",
          "alias_type": "VERSION",
          "id": 6500,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "reactjs 18",
          "alias_type": "VERSION",
          "id": 2075,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 5,
        "display_name": "React",
        "id": 610,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "FRAMEWORK",
        "slug": "react",
        "sub_category_id": 1072,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Application Frameworks \u0026 Libraries",
            "id": 451,
            "rationale": "Covers the primary software frameworks and libraries often used alongside Sitecore for building and enhancing site experiences.",
            "slug": "application-frameworks-libraries",
            "source": "db"
          },
          "input_skill": "React",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Sitecore Dev",
              "id": 233,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "sitecore-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Frameworks \u0026 Libraries",
            "id": 360,
            "rationale": "Manage adoption, integration, and best practices around key software frameworks and libraries.",
            "slug": "frameworks-libraries",
            "source": "db"
          },
          "input_skill": "React",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Drupal Dev",
              "id": 228,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "drupal-dev",
              "source": "db"
            },
            {
              "display_name": "Engineering Manager",
              "id": 121,
              "rationale": null,
              "role_archetype": null,
              "slug": "engineering-manager",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Frontend Frameworks and Libraries",
            "id": 434,
            "rationale": "Utilizing modern JavaScript frameworks and Shopify libraries to build dynamic and interactive storefronts.",
            "slug": "frontend-frameworks-and-libraries",
            "source": "db"
          },
          "input_skill": "React",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Shopify Dev",
              "id": 230,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "shopify-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "JavaScript for WordPress",
            "id": 329,
            "rationale": "Client-side scripting used to enhance WordPress themes, blocks, and admin/editor interactions. This includes modern JavaScript patterns as they apply to WordPress-specific behavior rather than standalone frontend applications.",
            "slug": "javascript-for-wordpress",
            "source": "db"
          },
          "input_skill": "React",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "WordPress Dev",
              "id": 227,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "wordpress-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "React Component Architecture",
            "id": 302,
            "rationale": "Building reusable React components, composing props and children, and managing rendering behavior across feature screens. This is the primary framework cluster for a React frontend developer.",
            "slug": "react-component-architecture",
            "source": "db"
          },
          "input_skill": "React",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "React Frontend Developer",
              "id": 89,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-frontend-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "UI Frameworks and Rendering",
            "id": 115,
            "rationale": "Component frameworks and rendering models used to build browser screens, reusable UI, and interactive client flows. This is a core cluster because frontend engineers spend much of their time composing and updating view hierarchies.",
            "slug": "ui-frameworks-and-rendering",
            "source": "db"
          },
          "input_skill": "React",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Frontend Developer",
              "id": 7,
              "rationale": null,
              "role_archetype": null,
              "slug": "frontend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            },
            {
              "display_name": "Hybrid Mobile Developer",
              "id": 11,
              "rationale": null,
              "role_archetype": null,
              "slug": "hybrid-mobile-developer",
              "source": "db"
            },
            {
              "display_name": "Ionic Developer",
              "id": 434,
              "rationale": null,
              "role_archetype": null,
              "slug": "ionic-developer",
              "source": "db"
            },
            {
              "display_name": "Web Developer",
              "id": 25,
              "rationale": null,
              "role_archetype": null,
              "slug": "web-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "React",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "Agile",
          "alias_type": "CANONICAL",
          "id": 868,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 8,
        "display_name": "Agile",
        "id": 520,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "METHODOLOGY",
        "slug": "agile",
        "sub_category_id": 3594,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "React Frontend Development",
            "id": 96,
            "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
            "slug": "d_init_01",
            "source": "db"
          },
          "input_skill": "Agile",
          "llm_role": null,
          "roles_from_db": []
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Software Concepts, Patterns \u0026 Practices",
            "id": 478,
            "rationale": "Champion foundational software design patterns, development methodologies, and engineering best practices.",
            "slug": "software-concepts-patterns-practices",
            "source": "db"
          },
          "input_skill": "Agile",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Engineering Manager",
              "id": 121,
              "rationale": null,
              "role_archetype": null,
              "slug": "engineering-manager",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "Agile",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "Git",
          "alias_type": "CANONICAL",
          "id": 1613,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 13,
        "display_name": "Git",
        "id": 1002,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "TOOL",
        "slug": "git",
        "sub_category_id": 730,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "React Frontend Development",
            "id": 96,
            "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
            "slug": "d_init_01",
            "source": "db"
          },
          "input_skill": "Git",
          "llm_role": null,
          "roles_from_db": []
        }
      ],
      "input_skill": "Git",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [],
      "canonical": null,
      "dimensions": [],
      "input_skill": "Perforce",
      "matched_via": null,
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": {
        "derived": {
          "category": "Version Control Systems",
          "skill_nature": "TOOL",
          "sub_category": "general",
          "typical_lifespan": "MULTI_YEAR",
          "version_strategy": "UNVERSIONED",
          "volatility": "MEDIUM"
        },
        "enrichment": null,
        "keep_log": [],
        "locked_dimensions": [],
        "merge_log": [],
        "placed": null,
        "relationships": null,
        "skill_id": "perforce",
        "split_log": [],
        "typed": null,
        "warnings": []
      },
      "source_tag": "llm",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "CI/CD",
          "alias_type": "CANONICAL",
          "id": 1826,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 8,
        "display_name": "CI/CD",
        "id": 1190,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "METHODOLOGY",
        "slug": "ci-cd",
        "sub_category_id": 900,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "CI/CD Pipeline Platforms",
            "id": 150,
            "rationale": "Systems used to define, run, and maintain automated build and deployment workflows. This cluster is coherent because the role owns delivery automation end to end, including pipeline reliability and promotion logic.",
            "slug": "ci-cd-pipeline-platforms",
            "source": "db"
          },
          "input_skill": "CI/CD",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "DevOps Engineer",
              "id": 10,
              "rationale": null,
              "role_archetype": null,
              "slug": "devops-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "CI/CD for Machine Learning",
            "id": 56,
            "rationale": "Tools and platforms for automating ML model integration, testing, and deployment pipelines.",
            "slug": "ci-cd-for-machine-learning",
            "source": "db"
          },
          "input_skill": "CI/CD",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "ML Engineer",
              "id": 3,
              "rationale": null,
              "role_archetype": null,
              "slug": "ml-engineer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "CI/CD",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "TypeScript",
          "alias_type": "CANONICAL",
          "id": 914,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "TypeScript 5",
          "alias_type": "VERSION",
          "id": 3157,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "TypeScript 5.x",
          "alias_type": "VERSION",
          "id": 3159,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ts",
          "alias_type": "VERSION",
          "id": 1647,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ts5",
          "alias_type": "VERSION",
          "id": 1648,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "typescript 5",
          "alias_type": "VERSION",
          "id": 1649,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "typescript 5.x",
          "alias_type": "VERSION",
          "id": 1650,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "typescript5",
          "alias_type": "VERSION",
          "id": 2179,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 6,
        "display_name": "TypeScript",
        "id": 524,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "typescript",
        "sub_category_id": 96,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Cross-Platform App Languages",
            "id": 167,
            "rationale": "Languages used to implement shared mobile features across iOS and Android from a common codebase. This is the primary coding surface for hybrid app logic, UI behavior, and platform-specific branching.",
            "slug": "cross-platform-app-languages",
            "source": "db"
          },
          "input_skill": "TypeScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Hybrid Mobile Developer",
              "id": 11,
              "rationale": null,
              "role_archetype": null,
              "slug": "hybrid-mobile-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "JavaScript and TypeScript",
            "id": 114,
            "rationale": "Primary implementation languages for browser client code, UI logic, and shared frontend utilities. These languages are the main coding surface for building interactive web experiences in this role.",
            "slug": "javascript-and-typescript",
            "source": "db"
          },
          "input_skill": "TypeScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Angular Frontend Developer",
              "id": 90,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "angular-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Frontend Developer",
              "id": 7,
              "rationale": null,
              "role_archetype": null,
              "slug": "frontend-engineer",
              "source": "db"
            },
            {
              "display_name": "Ionic Developer",
              "id": 434,
              "rationale": null,
              "role_archetype": null,
              "slug": "ionic-developer",
              "source": "db"
            },
            {
              "display_name": "Node.js Backend Developer",
              "id": 82,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "node-backend-developer",
              "source": "db"
            },
            {
              "display_name": "React Frontend Developer",
              "id": 89,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "React Native Developer",
              "id": 73,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-native-developer",
              "source": "db"
            },
            {
              "display_name": "Svelte Frontend Developer",
              "id": 92,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "svelte-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Vue Frontend Developer",
              "id": 91,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "vue-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Web Developer",
              "id": 25,
              "rationale": null,
              "role_archetype": null,
              "slug": "web-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages",
            "id": 1,
            "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
            "slug": "programming-languages",
            "source": "db"
          },
          "input_skill": "TypeScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Backend Developer",
              "id": 1,
              "rationale": null,
              "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
              "slug": "backend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages for XR",
            "id": 97,
            "rationale": "Primary implementation languages used to build immersive client features, interaction logic, and device-specific runtime behavior. This is the core coding surface for AR/VR experiences.",
            "slug": "programming-languages-for-xr",
            "source": "db"
          },
          "input_skill": "TypeScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "AR/VR Engineer",
              "id": 8,
              "rationale": null,
              "role_archetype": null,
              "slug": "ar-vr-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Sitecore Development Languages",
            "id": 438,
            "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
            "slug": "sitecore-development-languages",
            "source": "db"
          },
          "input_skill": "TypeScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Sitecore Dev",
              "id": 233,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "sitecore-dev",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "TypeScript",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "pytest",
          "alias_type": "CANONICAL",
          "id": 3666,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 13,
        "display_name": "pytest",
        "id": 2370,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "TOOL",
        "slug": "pytest",
        "sub_category_id": 513,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Testing and Quality Assurance",
            "id": 12,
            "rationale": "Backend-specific test strategies used to validate service behavior and integration points. Covers automated test layers, contract checks, fixtures, and regression prevention.",
            "slug": "testing-and-quality-assurance",
            "source": "db"
          },
          "input_skill": "pytest",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": ".NET Backend Developer",
              "id": 83,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "dotnet-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Backend Developer",
              "id": 1,
              "rationale": null,
              "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
              "slug": "backend-engineer",
              "source": "db"
            },
            {
              "display_name": "Node.js Backend Developer",
              "id": 82,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "node-backend-developer",
              "source": "db"
            },
            {
              "display_name": "PHP Backend Developer",
              "id": 86,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "php-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Python Backend Developer",
              "id": 80,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "python-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Scala Backend Developer",
              "id": 87,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "scala-backend-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "pytest",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "Django",
          "alias_type": "CANONICAL",
          "id": 82,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 1",
          "alias_type": "VERSION",
          "id": 83,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 1.x",
          "alias_type": "VERSION",
          "id": 88,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 2",
          "alias_type": "VERSION",
          "id": 84,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 2.x",
          "alias_type": "VERSION",
          "id": 89,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 3",
          "alias_type": "VERSION",
          "id": 85,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 3.x",
          "alias_type": "VERSION",
          "id": 90,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 4",
          "alias_type": "VERSION",
          "id": 86,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 4.x",
          "alias_type": "VERSION",
          "id": 91,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 5",
          "alias_type": "VERSION",
          "id": 87,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django 5.x",
          "alias_type": "VERSION",
          "id": 92,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django1",
          "alias_type": "VERSION",
          "id": 2285,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django2",
          "alias_type": "VERSION",
          "id": 2286,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django3",
          "alias_type": "VERSION",
          "id": 2287,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django4",
          "alias_type": "VERSION",
          "id": 2288,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "Django5",
          "alias_type": "VERSION",
          "id": 2289,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 2",
          "alias_type": "VERSION",
          "id": 6523,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 2.x",
          "alias_type": "VERSION",
          "id": 6531,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 3",
          "alias_type": "VERSION",
          "id": 6524,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 3.x",
          "alias_type": "VERSION",
          "id": 6532,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 4",
          "alias_type": "VERSION",
          "id": 6525,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 4.x",
          "alias_type": "VERSION",
          "id": 6533,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 5",
          "alias_type": "VERSION",
          "id": 3569,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 5.0",
          "alias_type": "VERSION",
          "id": 3572,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django 5.x",
          "alias_type": "VERSION",
          "id": 3573,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django2",
          "alias_type": "VERSION",
          "id": 6519,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django2.x",
          "alias_type": "VERSION",
          "id": 6527,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django3",
          "alias_type": "VERSION",
          "id": 6520,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django3.x",
          "alias_type": "VERSION",
          "id": 6528,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django4",
          "alias_type": "VERSION",
          "id": 6521,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django4.x",
          "alias_type": "VERSION",
          "id": 6529,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django5",
          "alias_type": "VERSION",
          "id": 3568,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django5.0",
          "alias_type": "VERSION",
          "id": 3570,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "django5.x",
          "alias_type": "VERSION",
          "id": 3571,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 5,
        "display_name": "Django",
        "id": 9,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "FRAMEWORK",
        "slug": "django",
        "sub_category_id": 35,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Frameworks \u0026 Libraries",
            "id": 360,
            "rationale": "Manage adoption, integration, and best practices around key software frameworks and libraries.",
            "slug": "frameworks-libraries",
            "source": "db"
          },
          "input_skill": "Django",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Drupal Dev",
              "id": 228,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "drupal-dev",
              "source": "db"
            },
            {
              "display_name": "Engineering Manager",
              "id": 121,
              "rationale": null,
              "role_archetype": null,
              "slug": "engineering-manager",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Web Application Frameworks",
            "id": 2,
            "rationale": "Server frameworks and runtimes used to build HTTP services, controllers, middleware, and request pipelines. These frameworks shape how backend endpoints are structured and delivered.",
            "slug": "web-application-frameworks",
            "source": "db"
          },
          "input_skill": "Django",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Backend Developer",
              "id": 1,
              "rationale": null,
              "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
              "slug": "backend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Java Backend Developer",
              "id": 79,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "java-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Node.js Backend Developer",
              "id": 82,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "node-backend-developer",
              "source": "db"
            },
            {
              "display_name": "PHP Backend Developer",
              "id": 86,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "php-backend-developer",
              "source": "db"
            },
            {
              "display_name": "Python Backend Developer",
              "id": 80,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "python-backend-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "Django",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "JavaScript",
          "alias_type": "CANONICAL",
          "id": 1028,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2015",
          "alias_type": "VERSION",
          "id": 1031,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2016",
          "alias_type": "VERSION",
          "id": 1032,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2017",
          "alias_type": "VERSION",
          "id": 1033,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2018",
          "alias_type": "VERSION",
          "id": 1034,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2019",
          "alias_type": "VERSION",
          "id": 1035,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2020",
          "alias_type": "VERSION",
          "id": 1036,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2021",
          "alias_type": "VERSION",
          "id": 1037,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2022",
          "alias_type": "VERSION",
          "id": 1038,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2023",
          "alias_type": "VERSION",
          "id": 1039,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES2024",
          "alias_type": "VERSION",
          "id": 1040,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES5",
          "alias_type": "VERSION",
          "id": 1029,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "ES6",
          "alias_type": "VERSION",
          "id": 1030,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "JavaScript ES2015",
          "alias_type": "VERSION",
          "id": 1042,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "JavaScript ES2020",
          "alias_type": "VERSION",
          "id": 1043,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "JavaScript ES6",
          "alias_type": "VERSION",
          "id": 1041,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        },
        {
          "alias_text": "modern JavaScript",
          "alias_type": "VERSION",
          "id": 1044,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 6,
        "display_name": "JavaScript",
        "id": 607,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "javascript",
        "sub_category_id": 96,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Cross-Platform App Languages",
            "id": 167,
            "rationale": "Languages used to implement shared mobile features across iOS and Android from a common codebase. This is the primary coding surface for hybrid app logic, UI behavior, and platform-specific branching.",
            "slug": "cross-platform-app-languages",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Hybrid Mobile Developer",
              "id": 11,
              "rationale": null,
              "role_archetype": null,
              "slug": "hybrid-mobile-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "JavaScript and TypeScript",
            "id": 114,
            "rationale": "Primary implementation languages for browser client code, UI logic, and shared frontend utilities. These languages are the main coding surface for building interactive web experiences in this role.",
            "slug": "javascript-and-typescript",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Angular Frontend Developer",
              "id": 90,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "angular-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Frontend Developer",
              "id": 7,
              "rationale": null,
              "role_archetype": null,
              "slug": "frontend-engineer",
              "source": "db"
            },
            {
              "display_name": "Ionic Developer",
              "id": 434,
              "rationale": null,
              "role_archetype": null,
              "slug": "ionic-developer",
              "source": "db"
            },
            {
              "display_name": "Node.js Backend Developer",
              "id": 82,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "node-backend-developer",
              "source": "db"
            },
            {
              "display_name": "React Frontend Developer",
              "id": 89,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "React Native Developer",
              "id": 73,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-native-developer",
              "source": "db"
            },
            {
              "display_name": "Svelte Frontend Developer",
              "id": 92,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "svelte-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Vue Frontend Developer",
              "id": 91,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "vue-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Web Developer",
              "id": 25,
              "rationale": null,
              "role_archetype": null,
              "slug": "web-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "JavaScript for WordPress",
            "id": 329,
            "rationale": "Client-side scripting used to enhance WordPress themes, blocks, and admin/editor interactions. This includes modern JavaScript patterns as they apply to WordPress-specific behavior rather than standalone frontend applications.",
            "slug": "javascript-for-wordpress",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "WordPress Dev",
              "id": 227,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "wordpress-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Pega Programming Languages \u0026 DSLs",
            "id": 267,
            "rationale": "Programming languages and domain-specific languages used in Pega development.",
            "slug": "pega-programming-languages-dsls",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Pega Developer",
              "id": 24,
              "rationale": null,
              "role_archetype": null,
              "slug": "pega-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages",
            "id": 1,
            "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
            "slug": "programming-languages",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Backend Developer",
              "id": 1,
              "rationale": null,
              "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
              "slug": "backend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages \u0026 DSLs",
            "id": 475,
            "rationale": "Oversee and guide the selection and effective use of programming and domain\u2010specific languages in software projects.",
            "slug": "programming-languages-dsls",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Engineering Manager",
              "id": 121,
              "rationale": null,
              "role_archetype": null,
              "slug": "engineering-manager",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages \u0026 Template Languages",
            "id": 359,
            "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
            "slug": "programming-languages-template-languages",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Drupal Dev",
              "id": 228,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "drupal-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Sitecore Development Languages",
            "id": 438,
            "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
            "slug": "sitecore-development-languages",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Sitecore Dev",
              "id": 233,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "sitecore-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Storefront JavaScript and DOM Behavior",
            "id": 422,
            "rationale": "Client-side behavior used to enhance Shopify storefront interactions beyond static theme rendering. This includes interactive UI logic, event handling, and progressive enhancement within theme constraints.",
            "slug": "storefront-javascript-and-dom-behavior",
            "source": "db"
          },
          "input_skill": "JavaScript",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Shopify Dev",
              "id": 230,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "shopify-dev",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "JavaScript",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "HTML",
          "alias_type": "CANONICAL",
          "id": 2627,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 6,
        "display_name": "HTML",
        "id": 1657,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "html",
        "sub_category_id": 1467,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Pega Programming Languages \u0026 DSLs",
            "id": 267,
            "rationale": "Programming languages and domain-specific languages used in Pega development.",
            "slug": "pega-programming-languages-dsls",
            "source": "db"
          },
          "input_skill": "HTML",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Pega Developer",
              "id": 24,
              "rationale": null,
              "role_archetype": null,
              "slug": "pega-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages \u0026 Template Languages",
            "id": 359,
            "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
            "slug": "programming-languages-template-languages",
            "source": "db"
          },
          "input_skill": "HTML",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Drupal Dev",
              "id": 228,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "drupal-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "React Frontend Development",
            "id": 96,
            "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
            "slug": "d_init_01",
            "source": "db"
          },
          "input_skill": "HTML",
          "llm_role": null,
          "roles_from_db": []
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Sitecore Development Languages",
            "id": 438,
            "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
            "slug": "sitecore-development-languages",
            "source": "db"
          },
          "input_skill": "HTML",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Sitecore Dev",
              "id": 233,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "sitecore-dev",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "HTML",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "CSS",
          "alias_type": "CANONICAL",
          "id": 1107,
          "is_primary": true,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 6,
        "display_name": "CSS",
        "id": 623,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "LANGUAGE",
        "slug": "css",
        "sub_category_id": 486,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "CSS Architecture and Styling",
            "id": 117,
            "rationale": "Styling systems and layout techniques used to create responsive, maintainable visual presentation in the browser. Frontend engineers need this to translate design intent into consistent interfaces.",
            "slug": "css-architecture-and-styling",
            "source": "db"
          },
          "input_skill": "CSS",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Frontend Developer",
              "id": 7,
              "rationale": null,
              "role_archetype": null,
              "slug": "frontend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 435,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "fullstack-developer",
              "source": "db"
            },
            {
              "display_name": "React Frontend Developer",
              "id": 89,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Svelte Frontend Developer",
              "id": 92,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "svelte-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Vue Frontend Developer",
              "id": 91,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "vue-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Web Developer",
              "id": 25,
              "rationale": null,
              "role_archetype": null,
              "slug": "web-developer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Programming Languages \u0026 Template Languages",
            "id": 359,
            "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
            "slug": "programming-languages-template-languages",
            "source": "db"
          },
          "input_skill": "CSS",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Drupal Dev",
              "id": 228,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "drupal-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Sitecore Development Languages",
            "id": 438,
            "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
            "slug": "sitecore-development-languages",
            "source": "db"
          },
          "input_skill": "CSS",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Sitecore Dev",
              "id": 233,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "sitecore-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Storefront Styling and Responsive Layout",
            "id": 423,
            "rationale": "Visual presentation work for Shopify storefronts, including layout, spacing, typography, and responsive behavior. This is a coherent cluster because theme developers must translate commerce designs into usable storefront pages.",
            "slug": "storefront-styling-and-responsive-layout",
            "source": "db"
          },
          "input_skill": "CSS",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Shopify Dev",
              "id": 230,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "shopify-dev",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Styling and Responsive Layout",
            "id": 307,
            "rationale": "Visual presentation techniques used to translate design requirements into usable Angular interfaces. This includes layout, theming, spacing, and responsive behavior across screen sizes.",
            "slug": "styling-and-responsive-layout",
            "source": "db"
          },
          "input_skill": "CSS",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Angular Frontend Developer",
              "id": 90,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "angular-frontend-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "CSS",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [],
      "canonical": null,
      "dimensions": [],
      "input_skill": "SVN",
      "matched_via": null,
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": {
        "derived": {
          "category": "Version Control Systems",
          "skill_nature": "TOOL",
          "sub_category": "general",
          "typical_lifespan": "MULTI_YEAR",
          "version_strategy": "UNVERSIONED",
          "volatility": "MEDIUM"
        },
        "enrichment": null,
        "keep_log": [],
        "locked_dimensions": [],
        "merge_log": [],
        "placed": null,
        "relationships": null,
        "skill_id": "svn",
        "split_log": [],
        "typed": null,
        "warnings": []
      },
      "source_tag": "llm",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "DevOps",
          "alias_type": "CANONICAL",
          "id": 1852,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 8,
        "display_name": "DevOps",
        "id": 1216,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "METHODOLOGY",
        "slug": "devops",
        "sub_category_id": 922,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "CI/CD Pipeline Platforms",
            "id": 150,
            "rationale": "Systems used to define, run, and maintain automated build and deployment workflows. This cluster is coherent because the role owns delivery automation end to end, including pipeline reliability and promotion logic.",
            "slug": "ci-cd-pipeline-platforms",
            "source": "db"
          },
          "input_skill": "DevOps",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "DevOps Engineer",
              "id": 10,
              "rationale": null,
              "role_archetype": null,
              "slug": "devops-engineer",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Deployment and Release Patterns",
            "id": 140,
            "rationale": "Patterns for promoting changes safely across environments, including rollout, rollback, and release gating strategies. Cloud Architects define these patterns so teams can deploy consistently across the platform.",
            "slug": "deployment-and-release-patterns",
            "source": "db"
          },
          "input_skill": "DevOps",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Cloud Architect",
              "id": 9,
              "rationale": null,
              "role_archetype": null,
              "slug": "cloud-architect",
              "source": "db"
            }
          ]
        },
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "Infrastructure as Code",
            "id": 132,
            "rationale": "Declarative provisioning and environment definition tools used to codify cloud infrastructure, repeatable environments, and platform standards. Cloud Architects use these to express reference architectures and guardrails.",
            "slug": "infrastructure-as-code",
            "source": "db"
          },
          "input_skill": "DevOps",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Cloud Architect",
              "id": 9,
              "rationale": null,
              "role_archetype": null,
              "slug": "cloud-architect",
              "source": "db"
            },
            {
              "display_name": "DevOps Engineer",
              "id": 10,
              "rationale": null,
              "role_archetype": null,
              "slug": "devops-engineer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "DevOps",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    },
    {
      "aliases_in_db": [
        {
          "alias_text": "API",
          "alias_type": "CANONICAL",
          "id": 2514,
          "is_primary": false,
          "match_strategy": "CASE_INSENSITIVE"
        }
      ],
      "canonical": {
        "category_id": 2,
        "display_name": "API",
        "id": 1568,
        "is_also_category": false,
        "is_extractable": true,
        "skill_nature": "CONCEPT",
        "slug": "api",
        "sub_category_id": 1174,
        "typical_lifespan": "EVERGREEN",
        "volatility": "STABLE"
      },
      "dimensions": [
        {
          "dimension": {
            "difficulty_hint": "well_known",
            "display_name": "API Integration and Data Fetching",
            "id": 127,
            "rationale": "Client-side integration with backend endpoints and third-party services, including request shaping, response handling, and synchronization with UI state. This is central to frontend work because most screens depend on remote data.",
            "slug": "api-integration-and-data-fetching",
            "source": "db"
          },
          "input_skill": "API",
          "llm_role": null,
          "roles_from_db": [
            {
              "display_name": "Angular Frontend Developer",
              "id": 90,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "angular-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Frontend Developer",
              "id": 7,
              "rationale": null,
              "role_archetype": null,
              "slug": "frontend-engineer",
              "source": "db"
            },
            {
              "display_name": "Fullstack Developer",
              "id": 15,
              "rationale": null,
              "role_archetype": null,
              "slug": "full-stack-engineer",
              "source": "db"
            },
            {
              "display_name": "React Frontend Developer",
              "id": 89,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "react-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Svelte Frontend Developer",
              "id": 92,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "svelte-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Vue Frontend Developer",
              "id": 91,
              "rationale": null,
              "role_archetype": "Engineering",
              "slug": "vue-frontend-developer",
              "source": "db"
            },
            {
              "display_name": "Web Developer",
              "id": 25,
              "rationale": null,
              "role_archetype": null,
              "slug": "web-developer",
              "source": "db"
            }
          ]
        }
      ],
      "input_skill": "API",
      "matched_via": "alias",
      "new_alias_persisted": false,
      "new_alias_text": null,
      "new_skill_meta": null,
      "source_tag": "db",
      "was_in_llm_skills": true
    }
  ],
  "unmatched_skills": [
    "Perforce",
    "SVN"
  ]
}
API 3 — final-role-output
{
  "chosen_role": {
    "display_name": "Backend Developer",
    "id": 1,
    "rationale": "Domain=Software Engineering \u2192 sub-role python-backend-developer; The JD centers on Python-based application development with FastAPI/Django, APIs, CI/CD, and technical support, which best matches a backend developer role.",
    "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
    "slug": "backend-engineer",
    "source": "db"
  },
  "chosen_role_resolution": "in_db",
  "final_input_skills": [
    {
      "skill": "Python",
      "tag": "in_db"
    },
    {
      "skill": "FastAPI",
      "tag": "in_db"
    },
    {
      "skill": "React",
      "tag": "in_db"
    },
    {
      "skill": "Agile",
      "tag": "in_db"
    },
    {
      "skill": "Git",
      "tag": "in_db"
    },
    {
      "skill": "Perforce",
      "tag": "new"
    },
    {
      "skill": "CI/CD",
      "tag": "in_db"
    },
    {
      "skill": "TypeScript",
      "tag": "in_db"
    },
    {
      "skill": "pytest",
      "tag": "in_db"
    },
    {
      "skill": "Django",
      "tag": "in_db"
    },
    {
      "skill": "JavaScript",
      "tag": "in_db"
    },
    {
      "skill": "HTML",
      "tag": "in_db"
    },
    {
      "skill": "CSS",
      "tag": "in_db"
    },
    {
      "skill": "SVN",
      "tag": "new"
    },
    {
      "skill": "DevOps",
      "tag": "in_db"
    },
    {
      "skill": "API",
      "tag": "in_db"
    }
  ],
  "llm_cost_api1_usd": null,
  "llm_cost_api2_usd": null,
  "llm_cost_api3_usd": null,
  "llm_cost_total_usd": null,
  "persistence": {
    "items": [
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Cloud Security Scripting \u0026 DSL Languages",
          "id": 248,
          "rationale": "Proficiency in programming and domain-specific languages used to automate and script cloud security controls.",
          "slug": "cloud-security-scripting-dsl-languages",
          "source": "db"
        },
        "dimension_id": 248,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Cloud Security Engineer",
            "id": 23,
            "rationale": null,
            "role_archetype": null,
            "slug": "cloud-security-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages",
          "id": 1,
          "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
          "slug": "programming-languages",
          "source": "db"
        },
        "dimension_id": 1,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": true,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension saved",
        "role_dimension_saved": true,
        "roles_from_db": [
          {
            "display_name": "Backend Developer",
            "id": 1,
            "rationale": null,
            "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
            "slug": "backend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages \u0026 DSLs",
          "id": 475,
          "rationale": "Oversee and guide the selection and effective use of programming and domain\u2010specific languages in software projects.",
          "slug": "programming-languages-dsls",
          "source": "db"
        },
        "dimension_id": 475,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Engineering Manager",
            "id": 121,
            "rationale": null,
            "role_archetype": null,
            "slug": "engineering-manager",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages and Scripting",
          "id": 59,
          "rationale": "Languages used to write security automation, analysis scripts, detection logic, and remediation helpers. This is the primary implementation surface for a cybersecurity engineer across tooling and response workflows.",
          "slug": "programming-languages-and-scripting",
          "source": "db"
        },
        "dimension_id": 59,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Cyber Security Engineer",
            "id": 5,
            "rationale": null,
            "role_archetype": null,
            "slug": "cybersecurity-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages for Data Work",
          "id": 21,
          "rationale": "Languages used to implement data pipelines, transformations, and operational glue. This is the primary coding surface for building ingestion, enrichment, and automation logic in data engineering.",
          "slug": "programming-languages-for-data-work",
          "source": "db"
        },
        "dimension_id": 21,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Data Engineer",
            "id": 2,
            "rationale": null,
            "role_archetype": null,
            "slug": "data-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages for ML Systems",
          "id": 39,
          "rationale": "Languages used to build training code, inference services, evaluation jobs, and ML glue code. This is the primary implementation surface for ML engineers across experimentation and productionization.",
          "slug": "programming-languages-for-ml-systems",
          "source": "db"
        },
        "dimension_id": 39,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "ML Engineer",
            "id": 3,
            "rationale": null,
            "role_archetype": null,
            "slug": "ml-engineer",
            "source": "db"
          },
          {
            "display_name": "MLOps Engineer",
            "id": 16,
            "rationale": null,
            "role_archetype": null,
            "slug": "ml-ops-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages for XR",
          "id": 97,
          "rationale": "Primary implementation languages used to build immersive client features, interaction logic, and device-specific runtime behavior. This is the core coding surface for AR/VR experiences.",
          "slug": "programming-languages-for-xr",
          "source": "db"
        },
        "dimension_id": 97,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "AR/VR Engineer",
            "id": 8,
            "rationale": null,
            "role_archetype": null,
            "slug": "ar-vr-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Python Programming",
          "id": 290,
          "rationale": "Core Python language skills used to implement backend business logic, request handlers, integrations, and service internals. This is the primary coding surface for the role.",
          "slug": "python-programming",
          "source": "db"
        },
        "dimension_id": 290,
        "input_skill": "Python",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Python Backend Developer",
            "id": 80,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "python-backend-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 5,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "React Frontend Development",
          "id": 96,
          "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
          "slug": "d_init_01",
          "source": "db"
        },
        "dimension_id": 96,
        "input_skill": "FastAPI",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [],
        "skill_dimension_saved": true,
        "skill_id": 1201,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Web Application Frameworks",
          "id": 2,
          "rationale": "Server frameworks and runtimes used to build HTTP services, controllers, middleware, and request pipelines. These frameworks shape how backend endpoints are structured and delivered.",
          "slug": "web-application-frameworks",
          "source": "db"
        },
        "dimension_id": 2,
        "input_skill": "FastAPI",
        "llm_role": null,
        "matched_chosen_role": true,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension saved",
        "role_dimension_saved": true,
        "roles_from_db": [
          {
            "display_name": "Backend Developer",
            "id": 1,
            "rationale": null,
            "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
            "slug": "backend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Java Backend Developer",
            "id": 79,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "java-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Node.js Backend Developer",
            "id": 82,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "node-backend-developer",
            "source": "db"
          },
          {
            "display_name": "PHP Backend Developer",
            "id": 86,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "php-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Python Backend Developer",
            "id": 80,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "python-backend-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1201,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Application Frameworks \u0026 Libraries",
          "id": 451,
          "rationale": "Covers the primary software frameworks and libraries often used alongside Sitecore for building and enhancing site experiences.",
          "slug": "application-frameworks-libraries",
          "source": "db"
        },
        "dimension_id": 451,
        "input_skill": "React",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Sitecore Dev",
            "id": 233,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "sitecore-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 610,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Frameworks \u0026 Libraries",
          "id": 360,
          "rationale": "Manage adoption, integration, and best practices around key software frameworks and libraries.",
          "slug": "frameworks-libraries",
          "source": "db"
        },
        "dimension_id": 360,
        "input_skill": "React",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Drupal Dev",
            "id": 228,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "drupal-dev",
            "source": "db"
          },
          {
            "display_name": "Engineering Manager",
            "id": 121,
            "rationale": null,
            "role_archetype": null,
            "slug": "engineering-manager",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 610,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Frontend Frameworks and Libraries",
          "id": 434,
          "rationale": "Utilizing modern JavaScript frameworks and Shopify libraries to build dynamic and interactive storefronts.",
          "slug": "frontend-frameworks-and-libraries",
          "source": "db"
        },
        "dimension_id": 434,
        "input_skill": "React",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Shopify Dev",
            "id": 230,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "shopify-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 610,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "JavaScript for WordPress",
          "id": 329,
          "rationale": "Client-side scripting used to enhance WordPress themes, blocks, and admin/editor interactions. This includes modern JavaScript patterns as they apply to WordPress-specific behavior rather than standalone frontend applications.",
          "slug": "javascript-for-wordpress",
          "source": "db"
        },
        "dimension_id": 329,
        "input_skill": "React",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "WordPress Dev",
            "id": 227,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "wordpress-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 610,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "React Component Architecture",
          "id": 302,
          "rationale": "Building reusable React components, composing props and children, and managing rendering behavior across feature screens. This is the primary framework cluster for a React frontend developer.",
          "slug": "react-component-architecture",
          "source": "db"
        },
        "dimension_id": 302,
        "input_skill": "React",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "React Frontend Developer",
            "id": 89,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-frontend-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 610,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "UI Frameworks and Rendering",
          "id": 115,
          "rationale": "Component frameworks and rendering models used to build browser screens, reusable UI, and interactive client flows. This is a core cluster because frontend engineers spend much of their time composing and updating view hierarchies.",
          "slug": "ui-frameworks-and-rendering",
          "source": "db"
        },
        "dimension_id": 115,
        "input_skill": "React",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Frontend Developer",
            "id": 7,
            "rationale": null,
            "role_archetype": null,
            "slug": "frontend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          },
          {
            "display_name": "Hybrid Mobile Developer",
            "id": 11,
            "rationale": null,
            "role_archetype": null,
            "slug": "hybrid-mobile-developer",
            "source": "db"
          },
          {
            "display_name": "Ionic Developer",
            "id": 434,
            "rationale": null,
            "role_archetype": null,
            "slug": "ionic-developer",
            "source": "db"
          },
          {
            "display_name": "Web Developer",
            "id": 25,
            "rationale": null,
            "role_archetype": null,
            "slug": "web-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 610,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "React Frontend Development",
          "id": 96,
          "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
          "slug": "d_init_01",
          "source": "db"
        },
        "dimension_id": 96,
        "input_skill": "Agile",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [],
        "skill_dimension_saved": true,
        "skill_id": 520,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Software Concepts, Patterns \u0026 Practices",
          "id": 478,
          "rationale": "Champion foundational software design patterns, development methodologies, and engineering best practices.",
          "slug": "software-concepts-patterns-practices",
          "source": "db"
        },
        "dimension_id": 478,
        "input_skill": "Agile",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Engineering Manager",
            "id": 121,
            "rationale": null,
            "role_archetype": null,
            "slug": "engineering-manager",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 520,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "React Frontend Development",
          "id": 96,
          "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
          "slug": "d_init_01",
          "source": "db"
        },
        "dimension_id": 96,
        "input_skill": "Git",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [],
        "skill_dimension_saved": true,
        "skill_id": 1002,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "CI/CD Pipeline Platforms",
          "id": 150,
          "rationale": "Systems used to define, run, and maintain automated build and deployment workflows. This cluster is coherent because the role owns delivery automation end to end, including pipeline reliability and promotion logic.",
          "slug": "ci-cd-pipeline-platforms",
          "source": "db"
        },
        "dimension_id": 150,
        "input_skill": "CI/CD",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "DevOps Engineer",
            "id": 10,
            "rationale": null,
            "role_archetype": null,
            "slug": "devops-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1190,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "CI/CD for Machine Learning",
          "id": 56,
          "rationale": "Tools and platforms for automating ML model integration, testing, and deployment pipelines.",
          "slug": "ci-cd-for-machine-learning",
          "source": "db"
        },
        "dimension_id": 56,
        "input_skill": "CI/CD",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "ML Engineer",
            "id": 3,
            "rationale": null,
            "role_archetype": null,
            "slug": "ml-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1190,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Cross-Platform App Languages",
          "id": 167,
          "rationale": "Languages used to implement shared mobile features across iOS and Android from a common codebase. This is the primary coding surface for hybrid app logic, UI behavior, and platform-specific branching.",
          "slug": "cross-platform-app-languages",
          "source": "db"
        },
        "dimension_id": 167,
        "input_skill": "TypeScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Hybrid Mobile Developer",
            "id": 11,
            "rationale": null,
            "role_archetype": null,
            "slug": "hybrid-mobile-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 524,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "JavaScript and TypeScript",
          "id": 114,
          "rationale": "Primary implementation languages for browser client code, UI logic, and shared frontend utilities. These languages are the main coding surface for building interactive web experiences in this role.",
          "slug": "javascript-and-typescript",
          "source": "db"
        },
        "dimension_id": 114,
        "input_skill": "TypeScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Angular Frontend Developer",
            "id": 90,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "angular-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Frontend Developer",
            "id": 7,
            "rationale": null,
            "role_archetype": null,
            "slug": "frontend-engineer",
            "source": "db"
          },
          {
            "display_name": "Ionic Developer",
            "id": 434,
            "rationale": null,
            "role_archetype": null,
            "slug": "ionic-developer",
            "source": "db"
          },
          {
            "display_name": "Node.js Backend Developer",
            "id": 82,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "node-backend-developer",
            "source": "db"
          },
          {
            "display_name": "React Frontend Developer",
            "id": 89,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "React Native Developer",
            "id": 73,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-native-developer",
            "source": "db"
          },
          {
            "display_name": "Svelte Frontend Developer",
            "id": 92,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "svelte-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Vue Frontend Developer",
            "id": 91,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "vue-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Web Developer",
            "id": 25,
            "rationale": null,
            "role_archetype": null,
            "slug": "web-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 524,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages",
          "id": 1,
          "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
          "slug": "programming-languages",
          "source": "db"
        },
        "dimension_id": 1,
        "input_skill": "TypeScript",
        "llm_role": null,
        "matched_chosen_role": true,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension saved",
        "role_dimension_saved": true,
        "roles_from_db": [
          {
            "display_name": "Backend Developer",
            "id": 1,
            "rationale": null,
            "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
            "slug": "backend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 524,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages for XR",
          "id": 97,
          "rationale": "Primary implementation languages used to build immersive client features, interaction logic, and device-specific runtime behavior. This is the core coding surface for AR/VR experiences.",
          "slug": "programming-languages-for-xr",
          "source": "db"
        },
        "dimension_id": 97,
        "input_skill": "TypeScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "AR/VR Engineer",
            "id": 8,
            "rationale": null,
            "role_archetype": null,
            "slug": "ar-vr-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 524,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Sitecore Development Languages",
          "id": 438,
          "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
          "slug": "sitecore-development-languages",
          "source": "db"
        },
        "dimension_id": 438,
        "input_skill": "TypeScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Sitecore Dev",
            "id": 233,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "sitecore-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 524,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Testing and Quality Assurance",
          "id": 12,
          "rationale": "Backend-specific test strategies used to validate service behavior and integration points. Covers automated test layers, contract checks, fixtures, and regression prevention.",
          "slug": "testing-and-quality-assurance",
          "source": "db"
        },
        "dimension_id": 12,
        "input_skill": "pytest",
        "llm_role": null,
        "matched_chosen_role": true,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension saved",
        "role_dimension_saved": true,
        "roles_from_db": [
          {
            "display_name": ".NET Backend Developer",
            "id": 83,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "dotnet-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Backend Developer",
            "id": 1,
            "rationale": null,
            "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
            "slug": "backend-engineer",
            "source": "db"
          },
          {
            "display_name": "Node.js Backend Developer",
            "id": 82,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "node-backend-developer",
            "source": "db"
          },
          {
            "display_name": "PHP Backend Developer",
            "id": 86,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "php-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Python Backend Developer",
            "id": 80,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "python-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Scala Backend Developer",
            "id": 87,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "scala-backend-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 2370,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Frameworks \u0026 Libraries",
          "id": 360,
          "rationale": "Manage adoption, integration, and best practices around key software frameworks and libraries.",
          "slug": "frameworks-libraries",
          "source": "db"
        },
        "dimension_id": 360,
        "input_skill": "Django",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Drupal Dev",
            "id": 228,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "drupal-dev",
            "source": "db"
          },
          {
            "display_name": "Engineering Manager",
            "id": 121,
            "rationale": null,
            "role_archetype": null,
            "slug": "engineering-manager",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 9,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Web Application Frameworks",
          "id": 2,
          "rationale": "Server frameworks and runtimes used to build HTTP services, controllers, middleware, and request pipelines. These frameworks shape how backend endpoints are structured and delivered.",
          "slug": "web-application-frameworks",
          "source": "db"
        },
        "dimension_id": 2,
        "input_skill": "Django",
        "llm_role": null,
        "matched_chosen_role": true,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension saved",
        "role_dimension_saved": true,
        "roles_from_db": [
          {
            "display_name": "Backend Developer",
            "id": 1,
            "rationale": null,
            "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
            "slug": "backend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Java Backend Developer",
            "id": 79,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "java-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Node.js Backend Developer",
            "id": 82,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "node-backend-developer",
            "source": "db"
          },
          {
            "display_name": "PHP Backend Developer",
            "id": 86,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "php-backend-developer",
            "source": "db"
          },
          {
            "display_name": "Python Backend Developer",
            "id": 80,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "python-backend-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 9,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Cross-Platform App Languages",
          "id": 167,
          "rationale": "Languages used to implement shared mobile features across iOS and Android from a common codebase. This is the primary coding surface for hybrid app logic, UI behavior, and platform-specific branching.",
          "slug": "cross-platform-app-languages",
          "source": "db"
        },
        "dimension_id": 167,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Hybrid Mobile Developer",
            "id": 11,
            "rationale": null,
            "role_archetype": null,
            "slug": "hybrid-mobile-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "JavaScript and TypeScript",
          "id": 114,
          "rationale": "Primary implementation languages for browser client code, UI logic, and shared frontend utilities. These languages are the main coding surface for building interactive web experiences in this role.",
          "slug": "javascript-and-typescript",
          "source": "db"
        },
        "dimension_id": 114,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Angular Frontend Developer",
            "id": 90,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "angular-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Frontend Developer",
            "id": 7,
            "rationale": null,
            "role_archetype": null,
            "slug": "frontend-engineer",
            "source": "db"
          },
          {
            "display_name": "Ionic Developer",
            "id": 434,
            "rationale": null,
            "role_archetype": null,
            "slug": "ionic-developer",
            "source": "db"
          },
          {
            "display_name": "Node.js Backend Developer",
            "id": 82,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "node-backend-developer",
            "source": "db"
          },
          {
            "display_name": "React Frontend Developer",
            "id": 89,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "React Native Developer",
            "id": 73,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-native-developer",
            "source": "db"
          },
          {
            "display_name": "Svelte Frontend Developer",
            "id": 92,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "svelte-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Vue Frontend Developer",
            "id": 91,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "vue-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Web Developer",
            "id": 25,
            "rationale": null,
            "role_archetype": null,
            "slug": "web-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "JavaScript for WordPress",
          "id": 329,
          "rationale": "Client-side scripting used to enhance WordPress themes, blocks, and admin/editor interactions. This includes modern JavaScript patterns as they apply to WordPress-specific behavior rather than standalone frontend applications.",
          "slug": "javascript-for-wordpress",
          "source": "db"
        },
        "dimension_id": 329,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "WordPress Dev",
            "id": 227,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "wordpress-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Pega Programming Languages \u0026 DSLs",
          "id": 267,
          "rationale": "Programming languages and domain-specific languages used in Pega development.",
          "slug": "pega-programming-languages-dsls",
          "source": "db"
        },
        "dimension_id": 267,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Pega Developer",
            "id": 24,
            "rationale": null,
            "role_archetype": null,
            "slug": "pega-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages",
          "id": 1,
          "rationale": "Primary implementation languages used to build client and server feature code. Full stack engineers need enough fluency to move across layers and implement product behavior end to end.",
          "slug": "programming-languages",
          "source": "db"
        },
        "dimension_id": 1,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": true,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension saved",
        "role_dimension_saved": true,
        "roles_from_db": [
          {
            "display_name": "Backend Developer",
            "id": 1,
            "rationale": null,
            "role_archetype": "A Backend Engineer designs, builds, and maintains the server-side logic and data handling that power applications and services. They focus on implementing reliable business functionality, integrating with other systems, and ensuring the backend is scalable, maintainable, and observable.",
            "slug": "backend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages \u0026 DSLs",
          "id": 475,
          "rationale": "Oversee and guide the selection and effective use of programming and domain\u2010specific languages in software projects.",
          "slug": "programming-languages-dsls",
          "source": "db"
        },
        "dimension_id": 475,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Engineering Manager",
            "id": 121,
            "rationale": null,
            "role_archetype": null,
            "slug": "engineering-manager",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages \u0026 Template Languages",
          "id": 359,
          "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
          "slug": "programming-languages-template-languages",
          "source": "db"
        },
        "dimension_id": 359,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Drupal Dev",
            "id": 228,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "drupal-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Sitecore Development Languages",
          "id": 438,
          "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
          "slug": "sitecore-development-languages",
          "source": "db"
        },
        "dimension_id": 438,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Sitecore Dev",
            "id": 233,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "sitecore-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Storefront JavaScript and DOM Behavior",
          "id": 422,
          "rationale": "Client-side behavior used to enhance Shopify storefront interactions beyond static theme rendering. This includes interactive UI logic, event handling, and progressive enhancement within theme constraints.",
          "slug": "storefront-javascript-and-dom-behavior",
          "source": "db"
        },
        "dimension_id": 422,
        "input_skill": "JavaScript",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Shopify Dev",
            "id": 230,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "shopify-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 607,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Pega Programming Languages \u0026 DSLs",
          "id": 267,
          "rationale": "Programming languages and domain-specific languages used in Pega development.",
          "slug": "pega-programming-languages-dsls",
          "source": "db"
        },
        "dimension_id": 267,
        "input_skill": "HTML",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Pega Developer",
            "id": 24,
            "rationale": null,
            "role_archetype": null,
            "slug": "pega-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1657,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages \u0026 Template Languages",
          "id": 359,
          "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
          "slug": "programming-languages-template-languages",
          "source": "db"
        },
        "dimension_id": 359,
        "input_skill": "HTML",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Drupal Dev",
            "id": 228,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "drupal-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1657,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "React Frontend Development",
          "id": 96,
          "rationale": "Building interactive web user interfaces with React.js, including component composition, state management, hooks, and rendering patterns. React.js belongs here because it is a core library for client-side UI development in modern web applications.",
          "slug": "d_init_01",
          "source": "db"
        },
        "dimension_id": 96,
        "input_skill": "HTML",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [],
        "skill_dimension_saved": true,
        "skill_id": 1657,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Sitecore Development Languages",
          "id": 438,
          "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
          "slug": "sitecore-development-languages",
          "source": "db"
        },
        "dimension_id": 438,
        "input_skill": "HTML",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Sitecore Dev",
            "id": 233,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "sitecore-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1657,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "CSS Architecture and Styling",
          "id": 117,
          "rationale": "Styling systems and layout techniques used to create responsive, maintainable visual presentation in the browser. Frontend engineers need this to translate design intent into consistent interfaces.",
          "slug": "css-architecture-and-styling",
          "source": "db"
        },
        "dimension_id": 117,
        "input_skill": "CSS",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Frontend Developer",
            "id": 7,
            "rationale": null,
            "role_archetype": null,
            "slug": "frontend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 435,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "fullstack-developer",
            "source": "db"
          },
          {
            "display_name": "React Frontend Developer",
            "id": 89,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Svelte Frontend Developer",
            "id": 92,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "svelte-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Vue Frontend Developer",
            "id": 91,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "vue-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Web Developer",
            "id": 25,
            "rationale": null,
            "role_archetype": null,
            "slug": "web-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 623,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Programming Languages \u0026 Template Languages",
          "id": 359,
          "rationale": "The languages and domain-specific templating languages used for Drupal development and theming.",
          "slug": "programming-languages-template-languages",
          "source": "db"
        },
        "dimension_id": 359,
        "input_skill": "CSS",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Drupal Dev",
            "id": 228,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "drupal-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 623,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Sitecore Development Languages",
          "id": 438,
          "rationale": "Core implementation languages and markup used to build Sitecore customizations, rendering logic, and site behavior. This is the primary authoring surface for Sitecore-specific code and templates.",
          "slug": "sitecore-development-languages",
          "source": "db"
        },
        "dimension_id": 438,
        "input_skill": "CSS",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Sitecore Dev",
            "id": 233,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "sitecore-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 623,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Storefront Styling and Responsive Layout",
          "id": 423,
          "rationale": "Visual presentation work for Shopify storefronts, including layout, spacing, typography, and responsive behavior. This is a coherent cluster because theme developers must translate commerce designs into usable storefront pages.",
          "slug": "storefront-styling-and-responsive-layout",
          "source": "db"
        },
        "dimension_id": 423,
        "input_skill": "CSS",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Shopify Dev",
            "id": 230,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "shopify-dev",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 623,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Styling and Responsive Layout",
          "id": 307,
          "rationale": "Visual presentation techniques used to translate design requirements into usable Angular interfaces. This includes layout, theming, spacing, and responsive behavior across screen sizes.",
          "slug": "styling-and-responsive-layout",
          "source": "db"
        },
        "dimension_id": 307,
        "input_skill": "CSS",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Angular Frontend Developer",
            "id": 90,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "angular-frontend-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 623,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "CI/CD Pipeline Platforms",
          "id": 150,
          "rationale": "Systems used to define, run, and maintain automated build and deployment workflows. This cluster is coherent because the role owns delivery automation end to end, including pipeline reliability and promotion logic.",
          "slug": "ci-cd-pipeline-platforms",
          "source": "db"
        },
        "dimension_id": 150,
        "input_skill": "DevOps",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "DevOps Engineer",
            "id": 10,
            "rationale": null,
            "role_archetype": null,
            "slug": "devops-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1216,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Deployment and Release Patterns",
          "id": 140,
          "rationale": "Patterns for promoting changes safely across environments, including rollout, rollback, and release gating strategies. Cloud Architects define these patterns so teams can deploy consistently across the platform.",
          "slug": "deployment-and-release-patterns",
          "source": "db"
        },
        "dimension_id": 140,
        "input_skill": "DevOps",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Cloud Architect",
            "id": 9,
            "rationale": null,
            "role_archetype": null,
            "slug": "cloud-architect",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1216,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "Infrastructure as Code",
          "id": 132,
          "rationale": "Declarative provisioning and environment definition tools used to codify cloud infrastructure, repeatable environments, and platform standards. Cloud Architects use these to express reference architectures and guardrails.",
          "slug": "infrastructure-as-code",
          "source": "db"
        },
        "dimension_id": 132,
        "input_skill": "DevOps",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Cloud Architect",
            "id": 9,
            "rationale": null,
            "role_archetype": null,
            "slug": "cloud-architect",
            "source": "db"
          },
          {
            "display_name": "DevOps Engineer",
            "id": 10,
            "rationale": null,
            "role_archetype": null,
            "slug": "devops-engineer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1216,
        "skill_tag": "in_db",
        "skipped_reason": null
      },
      {
        "chosen_role_id": 1,
        "dimension": {
          "difficulty_hint": "well_known",
          "display_name": "API Integration and Data Fetching",
          "id": 127,
          "rationale": "Client-side integration with backend endpoints and third-party services, including request shaping, response handling, and synchronization with UI state. This is central to frontend work because most screens depend on remote data.",
          "slug": "api-integration-and-data-fetching",
          "source": "db"
        },
        "dimension_id": 127,
        "input_skill": "API",
        "llm_role": null,
        "matched_chosen_role": false,
        "outcome_line": "Existing dimension (library) \u00b7 Role\u2194dimension skipped (dimension not under chosen role)",
        "role_dimension_saved": false,
        "roles_from_db": [
          {
            "display_name": "Angular Frontend Developer",
            "id": 90,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "angular-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Frontend Developer",
            "id": 7,
            "rationale": null,
            "role_archetype": null,
            "slug": "frontend-engineer",
            "source": "db"
          },
          {
            "display_name": "Fullstack Developer",
            "id": 15,
            "rationale": null,
            "role_archetype": null,
            "slug": "full-stack-engineer",
            "source": "db"
          },
          {
            "display_name": "React Frontend Developer",
            "id": 89,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "react-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Svelte Frontend Developer",
            "id": 92,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "svelte-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Vue Frontend Developer",
            "id": 91,
            "rationale": null,
            "role_archetype": "Engineering",
            "slug": "vue-frontend-developer",
            "source": "db"
          },
          {
            "display_name": "Web Developer",
            "id": 25,
            "rationale": null,
            "role_archetype": null,
            "slug": "web-developer",
            "source": "db"
          }
        ],
        "skill_dimension_saved": true,
        "skill_id": 1568,
        "skill_tag": "in_db",
        "skipped_reason": null
      }
    ],
    "new_skills_created": 0,
    "role_dimension_saved": 0,
    "skill_dimension_saved": 0,
    "skipped": 0
  },
  "planner_output": null,
  "run_id": "2243157d-c955-4348-be07-5c5aefb33766"
}

LLM Calls

Every model call made for this run, in pipeline order. Click a card to see the model's response.

Loading…